Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M5Y7

Protein Details
Accession C5M5Y7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
82-106TTFNKNWKDYRKPVHRVPKWTKLSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 14, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
KEGG ctp:CTRG_01268  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFASLVRYGGYVWKYNKRISTAQKTKLRSRMKQVDENIENIYKGLLQIQGKSNGELTGIEKVDYLKFQFPKENEMIARDKYTTFNKNWKDYRKPVHRVPKWTKLSFRENPKYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.49
4 0.49
5 0.54
6 0.57
7 0.62
8 0.62
9 0.68
10 0.71
11 0.72
12 0.75
13 0.76
14 0.76
15 0.7
16 0.72
17 0.72
18 0.71
19 0.72
20 0.69
21 0.69
22 0.61
23 0.57
24 0.48
25 0.39
26 0.32
27 0.24
28 0.2
29 0.11
30 0.09
31 0.08
32 0.1
33 0.1
34 0.12
35 0.15
36 0.2
37 0.2
38 0.21
39 0.2
40 0.16
41 0.15
42 0.13
43 0.12
44 0.1
45 0.1
46 0.1
47 0.09
48 0.1
49 0.1
50 0.11
51 0.12
52 0.14
53 0.15
54 0.17
55 0.22
56 0.22
57 0.27
58 0.28
59 0.29
60 0.24
61 0.27
62 0.29
63 0.25
64 0.26
65 0.21
66 0.2
67 0.21
68 0.27
69 0.29
70 0.29
71 0.37
72 0.42
73 0.5
74 0.57
75 0.62
76 0.65
77 0.68
78 0.75
79 0.76
80 0.77
81 0.79
82 0.82
83 0.8
84 0.82
85 0.82
86 0.82
87 0.81
88 0.8
89 0.78
90 0.74
91 0.76
92 0.74
93 0.76