Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M506

Protein Details
Accession C5M506   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-126LASGCVSIRSKRKKKKKSKFVYQNGILSFHydrophilic
NLS Segment(s)
PositionSequence
106-116RSKRKKKKKSK
Subcellular Location(s) plas 9, nucl 8.5, mito 7, cyto_nucl 5.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ctp:CTRG_01984  -  
Amino Acid Sequences MLIYSCYYLKSTYFRVAKYDCDTLVAVYGPCIGKGNKNKRKTSSNIFNSSVFCIGLFLLSRLQMVCFILPHTTDIKNFFFFSYFLSKKKTVVFISYRLASGCVSIRSKRKKKKKSKFVYQNGILSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.39
4 0.42
5 0.42
6 0.41
7 0.32
8 0.31
9 0.3
10 0.24
11 0.23
12 0.18
13 0.13
14 0.1
15 0.13
16 0.1
17 0.1
18 0.13
19 0.12
20 0.19
21 0.29
22 0.41
23 0.46
24 0.55
25 0.61
26 0.65
27 0.71
28 0.7
29 0.7
30 0.69
31 0.68
32 0.65
33 0.61
34 0.57
35 0.51
36 0.46
37 0.36
38 0.25
39 0.17
40 0.11
41 0.09
42 0.08
43 0.06
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.06
55 0.06
56 0.06
57 0.08
58 0.1
59 0.11
60 0.12
61 0.16
62 0.17
63 0.18
64 0.18
65 0.17
66 0.15
67 0.14
68 0.16
69 0.21
70 0.21
71 0.21
72 0.26
73 0.27
74 0.28
75 0.31
76 0.34
77 0.27
78 0.32
79 0.34
80 0.33
81 0.37
82 0.35
83 0.33
84 0.27
85 0.27
86 0.2
87 0.18
88 0.16
89 0.16
90 0.19
91 0.24
92 0.34
93 0.44
94 0.55
95 0.64
96 0.73
97 0.79
98 0.87
99 0.93
100 0.94
101 0.94
102 0.95
103 0.96
104 0.95
105 0.95
106 0.9