Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T0Y7

Protein Details
Accession A0A5N6T0Y7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-58SGDRHYRDRSDPPKRKHNSDEASHQPYRKKVQLPKKEHQYPSVHydrophilic
NLS Segment(s)
PositionSequence
279-287REDKKAKDS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MPRDHSRSQSPVSRPSGDRHYRDRSDPPKRKHNSDEASHQPYRKKVQLPKKEHQYPSVNELKKRIRDVKRLLNRVDLPADARIVQERALAGYENDLEEEENRRERSKMIKKYHFVRFLDRKTASKDVKRLERRQKEVSDSDLDSAAKEQKLAALAQKLRVARVNLNYTIYYPLAERYVALYADAKKKKDQAKDGDNDEDGDAGYTLVHANAADKPAMWHTVEKCMKDGTLELLRDGKLKNGESGTETKKKANMDKKKTSVRDSAQHKDTTKTSVKPQGREDKKAKDSRGSSKNDSRHTRARQSSPDDNGDESDGGFFEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.61
4 0.61
5 0.62
6 0.61
7 0.65
8 0.63
9 0.66
10 0.71
11 0.71
12 0.73
13 0.77
14 0.77
15 0.78
16 0.81
17 0.83
18 0.81
19 0.81
20 0.77
21 0.74
22 0.74
23 0.72
24 0.74
25 0.7
26 0.66
27 0.61
28 0.6
29 0.61
30 0.59
31 0.59
32 0.61
33 0.67
34 0.73
35 0.77
36 0.8
37 0.83
38 0.86
39 0.8
40 0.78
41 0.76
42 0.68
43 0.66
44 0.66
45 0.6
46 0.53
47 0.57
48 0.57
49 0.55
50 0.6
51 0.63
52 0.62
53 0.67
54 0.73
55 0.76
56 0.77
57 0.79
58 0.73
59 0.71
60 0.65
61 0.58
62 0.51
63 0.41
64 0.33
65 0.27
66 0.26
67 0.18
68 0.16
69 0.15
70 0.14
71 0.13
72 0.12
73 0.11
74 0.11
75 0.11
76 0.1
77 0.08
78 0.09
79 0.09
80 0.08
81 0.08
82 0.08
83 0.07
84 0.08
85 0.12
86 0.14
87 0.18
88 0.19
89 0.21
90 0.21
91 0.23
92 0.33
93 0.39
94 0.46
95 0.51
96 0.59
97 0.63
98 0.7
99 0.76
100 0.74
101 0.65
102 0.65
103 0.64
104 0.59
105 0.62
106 0.57
107 0.5
108 0.48
109 0.54
110 0.5
111 0.47
112 0.49
113 0.47
114 0.55
115 0.61
116 0.65
117 0.68
118 0.71
119 0.72
120 0.73
121 0.7
122 0.65
123 0.58
124 0.52
125 0.45
126 0.37
127 0.31
128 0.26
129 0.22
130 0.16
131 0.16
132 0.15
133 0.11
134 0.1
135 0.09
136 0.09
137 0.1
138 0.1
139 0.11
140 0.14
141 0.15
142 0.17
143 0.2
144 0.19
145 0.19
146 0.21
147 0.21
148 0.19
149 0.23
150 0.24
151 0.22
152 0.23
153 0.23
154 0.21
155 0.21
156 0.17
157 0.13
158 0.1
159 0.1
160 0.09
161 0.08
162 0.08
163 0.07
164 0.08
165 0.08
166 0.08
167 0.1
168 0.13
169 0.22
170 0.25
171 0.26
172 0.27
173 0.34
174 0.4
175 0.45
176 0.49
177 0.49
178 0.54
179 0.58
180 0.59
181 0.55
182 0.49
183 0.42
184 0.34
185 0.26
186 0.17
187 0.12
188 0.08
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.06
198 0.08
199 0.07
200 0.07
201 0.09
202 0.1
203 0.12
204 0.12
205 0.15
206 0.15
207 0.26
208 0.29
209 0.29
210 0.29
211 0.27
212 0.27
213 0.23
214 0.23
215 0.18
216 0.2
217 0.19
218 0.19
219 0.21
220 0.21
221 0.23
222 0.23
223 0.22
224 0.21
225 0.22
226 0.24
227 0.22
228 0.23
229 0.24
230 0.3
231 0.33
232 0.36
233 0.36
234 0.36
235 0.39
236 0.43
237 0.49
238 0.53
239 0.57
240 0.59
241 0.68
242 0.73
243 0.79
244 0.8
245 0.77
246 0.75
247 0.7
248 0.69
249 0.67
250 0.67
251 0.63
252 0.63
253 0.59
254 0.54
255 0.5
256 0.49
257 0.48
258 0.43
259 0.45
260 0.5
261 0.54
262 0.55
263 0.63
264 0.66
265 0.67
266 0.72
267 0.72
268 0.72
269 0.76
270 0.78
271 0.73
272 0.72
273 0.72
274 0.72
275 0.74
276 0.71
277 0.7
278 0.71
279 0.74
280 0.75
281 0.76
282 0.73
283 0.74
284 0.76
285 0.77
286 0.77
287 0.77
288 0.76
289 0.77
290 0.78
291 0.74
292 0.72
293 0.64
294 0.57
295 0.5
296 0.43
297 0.35
298 0.27
299 0.21