Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T1Z9

Protein Details
Accession A0A5N6T1Z9   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-40HACKYIPSHRPHRPAKHSQCRTKRLNRYSVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 4, golg 4, plas 3, nucl 2, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MTDCLIPIIHACKYIPSHRPHRPAKHSQCRTKRLNRYSVLLTATDACSRCVRILALLRFFCLLFLDHPCMTTPDHYASVTTAIQPPAANTDYRCNSWPKKHGCQMID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.4
4 0.48
5 0.56
6 0.65
7 0.7
8 0.76
9 0.78
10 0.81
11 0.85
12 0.86
13 0.87
14 0.88
15 0.88
16 0.86
17 0.87
18 0.86
19 0.85
20 0.82
21 0.81
22 0.73
23 0.67
24 0.61
25 0.55
26 0.46
27 0.35
28 0.28
29 0.21
30 0.19
31 0.17
32 0.15
33 0.13
34 0.13
35 0.13
36 0.13
37 0.12
38 0.11
39 0.11
40 0.17
41 0.18
42 0.22
43 0.21
44 0.21
45 0.21
46 0.21
47 0.18
48 0.13
49 0.11
50 0.07
51 0.1
52 0.14
53 0.13
54 0.14
55 0.14
56 0.15
57 0.15
58 0.15
59 0.15
60 0.15
61 0.16
62 0.16
63 0.16
64 0.15
65 0.17
66 0.16
67 0.15
68 0.15
69 0.13
70 0.14
71 0.14
72 0.14
73 0.16
74 0.17
75 0.17
76 0.16
77 0.24
78 0.27
79 0.3
80 0.32
81 0.35
82 0.42
83 0.5
84 0.58
85 0.58
86 0.64
87 0.7