Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SQM7

Protein Details
Accession A0A5N6SQM7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MMCRPGKHEVGKKNPKRTRGBasic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 8, E.R. 6, extr 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MMCRPGKHEVGKKNPKRTRGISSMFIVPLFLLLFFFYSAFCLMTTTLPSLRLGPSLPVVFFVCFFLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.79
4 0.74
5 0.71
6 0.69
7 0.65
8 0.57
9 0.54
10 0.49
11 0.42
12 0.35
13 0.27
14 0.18
15 0.14
16 0.09
17 0.07
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.1
33 0.1
34 0.11
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.13
41 0.16
42 0.17
43 0.16
44 0.17
45 0.18
46 0.17
47 0.17