Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6SZ31

Protein Details
Accession A0A5N6SZ31    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
46-65MPRRGPKKSLETPGWRRRKRBasic
NLS Segment(s)
PositionSequence
48-66RRGPKKSLETPGWRRRKRI
Subcellular Location(s) mito 9, plas 9, nucl 5, cyto 2, extr 2
Family & Domain DBs
Amino Acid Sequences MMLSLDVSTASLTFHIWIVTALFYTRDNRGRGTPPDVVFPTANSSMPRRGPKKSLETPGWRRRKRIGPFASSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.07
10 0.08
11 0.1
12 0.15
13 0.2
14 0.21
15 0.22
16 0.26
17 0.29
18 0.31
19 0.34
20 0.34
21 0.3
22 0.32
23 0.31
24 0.29
25 0.25
26 0.22
27 0.2
28 0.16
29 0.16
30 0.14
31 0.16
32 0.18
33 0.24
34 0.32
35 0.32
36 0.35
37 0.39
38 0.45
39 0.52
40 0.55
41 0.58
42 0.58
43 0.64
44 0.71
45 0.76
46 0.8
47 0.75
48 0.73
49 0.74
50 0.76
51 0.74
52 0.75
53 0.73
54 0.7