Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MHN1

Protein Details
Accession C5MHN1    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-207NDDNTKKYFKRKYHEIQETKTSGRKGHYKKVKNARKKYBasic
NLS Segment(s)
PositionSequence
191-207SGRKGHYKKVKNARKKY
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ctp:CTRG_05574  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MPNDIHTIPESSETESFSERYHSQEDSTTLDDLFAELEKETQTSIPIEDYRSIEKSIRNLPKIKENLVSKSKKESIKIYDPIVVPKKQTETTDARWFNMKQPEMTPEIKRDLQIIKQRSALDPKRHYKKDKWEIPKYFQMGTIIEGNTEFYSARLKKKERGKTMVEELLNDDNTKKYFKRKYHEIQETKTSGRKGHYKKVKNARKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.22
4 0.18
5 0.22
6 0.19
7 0.23
8 0.24
9 0.23
10 0.23
11 0.25
12 0.27
13 0.25
14 0.27
15 0.23
16 0.2
17 0.19
18 0.17
19 0.14
20 0.12
21 0.08
22 0.07
23 0.06
24 0.07
25 0.07
26 0.08
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.12
33 0.13
34 0.15
35 0.17
36 0.19
37 0.21
38 0.22
39 0.23
40 0.23
41 0.24
42 0.27
43 0.34
44 0.39
45 0.41
46 0.44
47 0.44
48 0.51
49 0.52
50 0.5
51 0.47
52 0.43
53 0.45
54 0.49
55 0.51
56 0.44
57 0.48
58 0.51
59 0.48
60 0.47
61 0.46
62 0.43
63 0.47
64 0.48
65 0.43
66 0.41
67 0.38
68 0.42
69 0.41
70 0.35
71 0.28
72 0.27
73 0.29
74 0.26
75 0.26
76 0.26
77 0.26
78 0.31
79 0.39
80 0.38
81 0.35
82 0.37
83 0.36
84 0.36
85 0.37
86 0.33
87 0.24
88 0.25
89 0.27
90 0.28
91 0.3
92 0.26
93 0.21
94 0.24
95 0.24
96 0.23
97 0.23
98 0.2
99 0.24
100 0.3
101 0.31
102 0.29
103 0.32
104 0.32
105 0.32
106 0.39
107 0.4
108 0.42
109 0.46
110 0.54
111 0.6
112 0.65
113 0.69
114 0.68
115 0.72
116 0.74
117 0.75
118 0.75
119 0.76
120 0.75
121 0.75
122 0.75
123 0.66
124 0.56
125 0.48
126 0.4
127 0.3
128 0.26
129 0.24
130 0.17
131 0.14
132 0.13
133 0.13
134 0.11
135 0.11
136 0.09
137 0.06
138 0.15
139 0.18
140 0.24
141 0.31
142 0.35
143 0.42
144 0.52
145 0.62
146 0.63
147 0.67
148 0.66
149 0.64
150 0.67
151 0.67
152 0.57
153 0.48
154 0.43
155 0.4
156 0.35
157 0.28
158 0.23
159 0.19
160 0.2
161 0.23
162 0.23
163 0.28
164 0.37
165 0.45
166 0.53
167 0.61
168 0.7
169 0.77
170 0.85
171 0.82
172 0.79
173 0.8
174 0.75
175 0.69
176 0.64
177 0.56
178 0.49
179 0.48
180 0.52
181 0.51
182 0.57
183 0.64
184 0.68
185 0.75
186 0.83
187 0.87