Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q758A4

Protein Details
Accession Q758A4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-107EMQRAKNKKQKIDDTQEQRATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014849  EKC/KEOPS_Gon7  
Gene Ontology GO:0000785  C:chromatin  
GO:0000781  C:chromosome, telomeric region  
GO:0000408  C:EKC/KEOPS complex  
GO:0005634  C:nucleus  
GO:0031490  F:chromatin DNA binding  
GO:0000032  P:cell wall mannoprotein biosynthetic process  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0000722  P:telomere maintenance via recombination  
GO:0008033  P:tRNA processing  
KEGG ago:AGOS_AEL144W  -  
Pfam View protein in Pfam  
PF08738  Gon7  
Amino Acid Sequences MQPPTATYCTPEGDSHAFTVVPDAPRYRTTDGTTSGPSAYVLQAGQIDRDRPSPPKLDAQGEPTALSRLRMHLTGLQDDINSFLTAEMQRAKNKKQKIDDTQEQRATGGSTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.22
4 0.19
5 0.17
6 0.19
7 0.18
8 0.16
9 0.17
10 0.18
11 0.2
12 0.22
13 0.27
14 0.27
15 0.27
16 0.28
17 0.3
18 0.31
19 0.32
20 0.31
21 0.27
22 0.24
23 0.21
24 0.18
25 0.15
26 0.11
27 0.09
28 0.07
29 0.07
30 0.09
31 0.08
32 0.1
33 0.1
34 0.11
35 0.11
36 0.14
37 0.15
38 0.16
39 0.19
40 0.21
41 0.22
42 0.26
43 0.27
44 0.28
45 0.27
46 0.29
47 0.28
48 0.26
49 0.24
50 0.19
51 0.18
52 0.15
53 0.15
54 0.11
55 0.11
56 0.12
57 0.12
58 0.13
59 0.15
60 0.18
61 0.17
62 0.18
63 0.16
64 0.15
65 0.14
66 0.14
67 0.12
68 0.1
69 0.08
70 0.07
71 0.09
72 0.1
73 0.12
74 0.16
75 0.18
76 0.25
77 0.3
78 0.39
79 0.44
80 0.52
81 0.59
82 0.62
83 0.69
84 0.72
85 0.77
86 0.79
87 0.8
88 0.82
89 0.78
90 0.68
91 0.59
92 0.49
93 0.41