Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6T5K6

Protein Details
Accession A0A5N6T5K6    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
7-34WDPIKRIKMRLSDRQKKKPEQSETSPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021986  Spherulin4  
Pfam View protein in Pfam  
PF12138  Spherulin4  
Amino Acid Sequences MQALQAWDPIKRIKMRLSDRQKKKPEQSETSPTTMQTPPPSGIIVPLYIYPLSPTTWDPLYDSISANPDLHFLVIVNPNSGPGASPLPDANYVREIARLNRYANVVTVGYIAINYCKKPLPEALEEVQTYATWADDYERTGLGVGGIFLDETPNLSSSEAVEYLASLQHHIKSTPGLLGNRLVIQNPGTPPDAPLANIGPDLILTCEEPYSRYRSNEVQCRLRQLHYDRARCGYMIHSVPLEHLRSLVYELRHRAAYLFITEFFGEFYERFGPSSWTAMVEASQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.63
4 0.7
5 0.74
6 0.79
7 0.85
8 0.88
9 0.88
10 0.9
11 0.89
12 0.88
13 0.86
14 0.84
15 0.83
16 0.78
17 0.73
18 0.64
19 0.54
20 0.49
21 0.43
22 0.38
23 0.33
24 0.31
25 0.27
26 0.27
27 0.28
28 0.23
29 0.23
30 0.2
31 0.15
32 0.13
33 0.12
34 0.13
35 0.12
36 0.12
37 0.11
38 0.11
39 0.11
40 0.12
41 0.13
42 0.14
43 0.15
44 0.16
45 0.16
46 0.17
47 0.2
48 0.19
49 0.19
50 0.17
51 0.19
52 0.2
53 0.18
54 0.16
55 0.14
56 0.13
57 0.12
58 0.1
59 0.08
60 0.11
61 0.15
62 0.16
63 0.16
64 0.15
65 0.15
66 0.15
67 0.15
68 0.11
69 0.08
70 0.1
71 0.09
72 0.1
73 0.1
74 0.12
75 0.16
76 0.16
77 0.16
78 0.15
79 0.16
80 0.15
81 0.17
82 0.17
83 0.17
84 0.22
85 0.23
86 0.23
87 0.25
88 0.26
89 0.23
90 0.22
91 0.21
92 0.15
93 0.12
94 0.11
95 0.09
96 0.07
97 0.07
98 0.06
99 0.07
100 0.09
101 0.09
102 0.1
103 0.12
104 0.12
105 0.14
106 0.18
107 0.2
108 0.21
109 0.25
110 0.25
111 0.26
112 0.26
113 0.24
114 0.21
115 0.15
116 0.13
117 0.09
118 0.07
119 0.04
120 0.04
121 0.05
122 0.06
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.06
130 0.05
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.06
144 0.07
145 0.08
146 0.07
147 0.07
148 0.06
149 0.06
150 0.06
151 0.08
152 0.07
153 0.07
154 0.08
155 0.1
156 0.11
157 0.11
158 0.11
159 0.11
160 0.11
161 0.13
162 0.15
163 0.14
164 0.14
165 0.16
166 0.16
167 0.17
168 0.17
169 0.14
170 0.11
171 0.12
172 0.14
173 0.14
174 0.15
175 0.15
176 0.15
177 0.15
178 0.16
179 0.15
180 0.13
181 0.14
182 0.12
183 0.11
184 0.11
185 0.1
186 0.07
187 0.07
188 0.07
189 0.06
190 0.05
191 0.05
192 0.06
193 0.07
194 0.07
195 0.09
196 0.11
197 0.17
198 0.2
199 0.22
200 0.26
201 0.33
202 0.41
203 0.48
204 0.53
205 0.55
206 0.54
207 0.6
208 0.6
209 0.54
210 0.54
211 0.5
212 0.54
213 0.54
214 0.58
215 0.53
216 0.54
217 0.53
218 0.45
219 0.41
220 0.32
221 0.3
222 0.25
223 0.24
224 0.2
225 0.19
226 0.22
227 0.25
228 0.25
229 0.18
230 0.17
231 0.15
232 0.16
233 0.19
234 0.21
235 0.2
236 0.24
237 0.28
238 0.31
239 0.31
240 0.31
241 0.28
242 0.26
243 0.24
244 0.22
245 0.2
246 0.18
247 0.2
248 0.19
249 0.19
250 0.16
251 0.15
252 0.13
253 0.11
254 0.13
255 0.14
256 0.15
257 0.15
258 0.16
259 0.2
260 0.2
261 0.23
262 0.21
263 0.19
264 0.2