Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CT29

Protein Details
Accession A0A5N7CT29    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-43DDDIRRAKRKYSVLKRRISSHydrophilic
267-320HYHKTICVRSKKACKKRLSSMQDKESTSDRDHCMQRKRPRKQGKKPSVPSSTSTHydrophilic
NLS Segment(s)
PositionSequence
302-312RKRPRKQGKKP
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
Amino Acid Sequences EEEKVDEDPCLVAKAAKIQQAQSDDDIRRAKRKYSVLKRRISSSRLQKYQSQWVQSRRDWKILTRGRERPDHIEQSAEKQALCKLMPELGRLAAVMSSNEPLSFDEKASVVKDLFTQCLRDFDVVYRPGEEPVEKRCPVASCPWKSPYGAGASILYCWECYTFHDGKSAEFEEHCAGHLPLMTSQHYEVMVYRHTTIRAGYCIECMWDDRLPAACRMRAFDRSPELREHLEEHVDRKSCPSECADPSCNHIATEEQDYRRHLRDVHHYHKTICVRSKKACKKRLSSMQDKESTSDRDHCMQRKRPRKQGKKPSVPSSTSTKELKITFWEPHAMRPKAITSVPAQEKDKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.31
4 0.33
5 0.33
6 0.38
7 0.41
8 0.43
9 0.38
10 0.41
11 0.35
12 0.4
13 0.45
14 0.43
15 0.47
16 0.47
17 0.49
18 0.49
19 0.58
20 0.62
21 0.66
22 0.74
23 0.75
24 0.81
25 0.8
26 0.8
27 0.77
28 0.71
29 0.69
30 0.69
31 0.7
32 0.67
33 0.67
34 0.66
35 0.64
36 0.71
37 0.67
38 0.64
39 0.61
40 0.63
41 0.67
42 0.65
43 0.69
44 0.63
45 0.64
46 0.58
47 0.55
48 0.58
49 0.58
50 0.62
51 0.61
52 0.64
53 0.62
54 0.67
55 0.67
56 0.63
57 0.64
58 0.62
59 0.53
60 0.51
61 0.46
62 0.45
63 0.46
64 0.39
65 0.31
66 0.26
67 0.27
68 0.25
69 0.24
70 0.2
71 0.15
72 0.19
73 0.2
74 0.21
75 0.2
76 0.17
77 0.17
78 0.15
79 0.14
80 0.1
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.11
90 0.12
91 0.11
92 0.11
93 0.11
94 0.13
95 0.13
96 0.14
97 0.11
98 0.11
99 0.14
100 0.14
101 0.16
102 0.15
103 0.18
104 0.16
105 0.19
106 0.2
107 0.17
108 0.16
109 0.16
110 0.22
111 0.21
112 0.21
113 0.2
114 0.19
115 0.19
116 0.2
117 0.19
118 0.15
119 0.19
120 0.26
121 0.24
122 0.24
123 0.25
124 0.26
125 0.26
126 0.34
127 0.37
128 0.34
129 0.38
130 0.41
131 0.4
132 0.39
133 0.38
134 0.3
135 0.25
136 0.2
137 0.17
138 0.15
139 0.13
140 0.13
141 0.12
142 0.1
143 0.06
144 0.06
145 0.06
146 0.05
147 0.07
148 0.14
149 0.15
150 0.16
151 0.2
152 0.2
153 0.2
154 0.23
155 0.23
156 0.16
157 0.14
158 0.15
159 0.12
160 0.12
161 0.12
162 0.1
163 0.08
164 0.08
165 0.09
166 0.08
167 0.08
168 0.1
169 0.11
170 0.1
171 0.11
172 0.11
173 0.1
174 0.1
175 0.09
176 0.09
177 0.1
178 0.1
179 0.11
180 0.11
181 0.12
182 0.12
183 0.12
184 0.12
185 0.12
186 0.13
187 0.12
188 0.12
189 0.12
190 0.12
191 0.11
192 0.11
193 0.12
194 0.1
195 0.1
196 0.11
197 0.15
198 0.16
199 0.19
200 0.21
201 0.2
202 0.2
203 0.23
204 0.25
205 0.26
206 0.27
207 0.28
208 0.33
209 0.35
210 0.37
211 0.37
212 0.36
213 0.32
214 0.31
215 0.29
216 0.24
217 0.25
218 0.24
219 0.23
220 0.26
221 0.25
222 0.24
223 0.25
224 0.27
225 0.23
226 0.24
227 0.26
228 0.27
229 0.3
230 0.36
231 0.36
232 0.33
233 0.36
234 0.39
235 0.35
236 0.29
237 0.25
238 0.21
239 0.19
240 0.26
241 0.27
242 0.25
243 0.27
244 0.31
245 0.35
246 0.36
247 0.36
248 0.32
249 0.31
250 0.4
251 0.47
252 0.52
253 0.56
254 0.55
255 0.54
256 0.59
257 0.6
258 0.56
259 0.55
260 0.55
261 0.53
262 0.6
263 0.7
264 0.73
265 0.78
266 0.8
267 0.8
268 0.79
269 0.83
270 0.85
271 0.83
272 0.83
273 0.81
274 0.81
275 0.79
276 0.72
277 0.64
278 0.58
279 0.53
280 0.46
281 0.44
282 0.38
283 0.39
284 0.46
285 0.51
286 0.57
287 0.62
288 0.69
289 0.73
290 0.79
291 0.83
292 0.87
293 0.9
294 0.91
295 0.93
296 0.94
297 0.94
298 0.93
299 0.92
300 0.89
301 0.81
302 0.74
303 0.71
304 0.64
305 0.59
306 0.53
307 0.45
308 0.42
309 0.4
310 0.39
311 0.37
312 0.36
313 0.34
314 0.35
315 0.41
316 0.36
317 0.44
318 0.52
319 0.47
320 0.44
321 0.43
322 0.43
323 0.4
324 0.4
325 0.34
326 0.28
327 0.36
328 0.42
329 0.45