Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q756W7

Protein Details
Accession Q756W7    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-56AHLLKQLLRKAHKKKRALEAEVYHydrophilic
333-358QRQKALGVDRRPHKRHKGTTQDSALTHydrophilic
NLS Segment(s)
PositionSequence
42-49RKAHKKKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019622  Rrn9_dom  
Gene Ontology GO:0000500  C:RNA polymerase I upstream activating factor complex  
GO:0001181  F:RNA polymerase I general transcription initiation factor activity  
GO:0017025  F:TBP-class protein binding  
GO:0042790  P:nucleolar large rRNA transcription by RNA polymerase I  
GO:0045943  P:positive regulation of transcription by RNA polymerase I  
KEGG ago:AGOS_AER288C  -  
Pfam View protein in Pfam  
PF10680  RRN9  
Amino Acid Sequences MDVNGKTIANEALELLESLEQQHRHDLTLHLYSAHLLKQLLRKAHKKKRALEAEVYIKTMIKDNWTSWPSPNTVIDPHTDCVYEDEELWGSREEAPQMPERGEISERALKHAMRMMRVELDSVWQRQLTQSAALVHQLGQGNVSLDVNKMAMPLELVNHIFARLDAFAQGLNVNFAKQVKVELATQPSMPQLSLKTGTSDQRGSSSGASSTNSRRKAHLDYRDLIVRGCEMKLDMSNVYIKCLFLFEGLVSRYNVKDFKIPKEVLKKYVPQRQAEVVPRPVKNLQKEFWELEALTRDRNLTFDVRQALRQMCLRNGFSRDKKTFMMVQEINTQRQKALGVDRRPHKRHKGTTQDSALTDGGEEADDELYGLADCLIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.09
5 0.11
6 0.17
7 0.17
8 0.18
9 0.26
10 0.26
11 0.26
12 0.29
13 0.28
14 0.28
15 0.31
16 0.3
17 0.23
18 0.23
19 0.23
20 0.22
21 0.22
22 0.19
23 0.15
24 0.19
25 0.26
26 0.32
27 0.38
28 0.45
29 0.53
30 0.62
31 0.72
32 0.77
33 0.79
34 0.81
35 0.83
36 0.85
37 0.82
38 0.77
39 0.74
40 0.73
41 0.66
42 0.59
43 0.48
44 0.39
45 0.33
46 0.31
47 0.24
48 0.21
49 0.22
50 0.23
51 0.31
52 0.33
53 0.34
54 0.33
55 0.36
56 0.33
57 0.33
58 0.34
59 0.28
60 0.28
61 0.27
62 0.28
63 0.27
64 0.26
65 0.24
66 0.22
67 0.2
68 0.19
69 0.2
70 0.16
71 0.13
72 0.13
73 0.13
74 0.13
75 0.14
76 0.12
77 0.11
78 0.13
79 0.14
80 0.15
81 0.16
82 0.19
83 0.22
84 0.23
85 0.23
86 0.22
87 0.21
88 0.21
89 0.2
90 0.19
91 0.19
92 0.22
93 0.22
94 0.24
95 0.27
96 0.24
97 0.25
98 0.28
99 0.25
100 0.23
101 0.25
102 0.22
103 0.23
104 0.23
105 0.22
106 0.17
107 0.19
108 0.19
109 0.19
110 0.19
111 0.15
112 0.15
113 0.15
114 0.17
115 0.14
116 0.12
117 0.13
118 0.13
119 0.14
120 0.14
121 0.14
122 0.12
123 0.14
124 0.14
125 0.12
126 0.11
127 0.11
128 0.1
129 0.1
130 0.1
131 0.07
132 0.06
133 0.07
134 0.07
135 0.06
136 0.06
137 0.05
138 0.05
139 0.05
140 0.05
141 0.06
142 0.07
143 0.07
144 0.08
145 0.08
146 0.08
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.05
153 0.06
154 0.05
155 0.06
156 0.06
157 0.05
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.07
164 0.07
165 0.08
166 0.07
167 0.09
168 0.1
169 0.11
170 0.14
171 0.14
172 0.14
173 0.14
174 0.13
175 0.12
176 0.11
177 0.09
178 0.07
179 0.09
180 0.1
181 0.1
182 0.12
183 0.14
184 0.16
185 0.18
186 0.19
187 0.17
188 0.17
189 0.18
190 0.17
191 0.15
192 0.14
193 0.12
194 0.11
195 0.12
196 0.13
197 0.19
198 0.25
199 0.3
200 0.3
201 0.31
202 0.35
203 0.41
204 0.47
205 0.49
206 0.48
207 0.44
208 0.46
209 0.48
210 0.44
211 0.36
212 0.28
213 0.2
214 0.16
215 0.14
216 0.11
217 0.08
218 0.09
219 0.09
220 0.11
221 0.09
222 0.1
223 0.15
224 0.14
225 0.16
226 0.16
227 0.15
228 0.13
229 0.14
230 0.13
231 0.08
232 0.08
233 0.06
234 0.09
235 0.1
236 0.12
237 0.12
238 0.13
239 0.13
240 0.16
241 0.17
242 0.14
243 0.2
244 0.22
245 0.28
246 0.35
247 0.36
248 0.4
249 0.49
250 0.51
251 0.5
252 0.52
253 0.54
254 0.54
255 0.61
256 0.61
257 0.53
258 0.53
259 0.52
260 0.54
261 0.53
262 0.51
263 0.5
264 0.51
265 0.48
266 0.49
267 0.5
268 0.5
269 0.52
270 0.51
271 0.45
272 0.45
273 0.49
274 0.47
275 0.42
276 0.38
277 0.3
278 0.26
279 0.31
280 0.26
281 0.22
282 0.21
283 0.21
284 0.19
285 0.2
286 0.2
287 0.17
288 0.18
289 0.22
290 0.27
291 0.28
292 0.29
293 0.33
294 0.32
295 0.31
296 0.34
297 0.33
298 0.32
299 0.36
300 0.38
301 0.37
302 0.42
303 0.48
304 0.51
305 0.57
306 0.55
307 0.53
308 0.52
309 0.51
310 0.51
311 0.44
312 0.46
313 0.38
314 0.37
315 0.43
316 0.45
317 0.47
318 0.45
319 0.43
320 0.34
321 0.34
322 0.32
323 0.27
324 0.34
325 0.37
326 0.42
327 0.5
328 0.59
329 0.68
330 0.73
331 0.79
332 0.79
333 0.81
334 0.82
335 0.84
336 0.86
337 0.83
338 0.87
339 0.84
340 0.78
341 0.68
342 0.62
343 0.51
344 0.4
345 0.32
346 0.22
347 0.16
348 0.11
349 0.1
350 0.07
351 0.07
352 0.07
353 0.07
354 0.06
355 0.06
356 0.06
357 0.06