Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6I276

Protein Details
Accession A0A5N6I276    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-92SPTGPAGSTRQRKRKSNPMQPATSHydrophilic
NLS Segment(s)
PositionSequence
62-83RSRTRSGSPTGPAGSTRQRKRK
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR037997  Dgk1-like  
Gene Ontology GO:0016020  C:membrane  
GO:0004143  F:diacylglycerol kinase activity  
Amino Acid Sequences MSSQDAIPETPRVISPSPAPSESRSRSRDGYSAPTTRSAARRQRLVDVSEESNNERGSGSRRSRTRSGSPTGPAGSTRQRKRKSNPMQPATSPEKQTNGGAKPNGFLSPFGKADGIAPSISRSPSPMGLIPLHTRYRNFIHRHEIPRKALHVSIGFFTLHLYSRGIQTTQITPWLFGALVPIAAVDIVRHRSETINKLYIRCVGALMRETEVKGYNGVIWYLLGAYAVLRFFPKDVGVMGVLLLSWCDTAASTFGRLYGRHTFQLRAGKSFAGTVSAWLVGVVTAAAFWGLFVPNVGPFPNDPENAFMFTGRLNLVPDTVKNLIGWTADTVISGPLALGVMSVVSGLVAAGSEFVDLFGWDDNFTIPILSGIGLWGFLKVFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.31
4 0.35
5 0.36
6 0.37
7 0.37
8 0.45
9 0.49
10 0.53
11 0.5
12 0.5
13 0.52
14 0.53
15 0.54
16 0.48
17 0.5
18 0.49
19 0.5
20 0.47
21 0.46
22 0.44
23 0.45
24 0.46
25 0.48
26 0.5
27 0.52
28 0.57
29 0.56
30 0.63
31 0.62
32 0.58
33 0.53
34 0.48
35 0.44
36 0.41
37 0.4
38 0.34
39 0.32
40 0.3
41 0.26
42 0.21
43 0.2
44 0.21
45 0.29
46 0.34
47 0.38
48 0.44
49 0.5
50 0.57
51 0.62
52 0.66
53 0.64
54 0.63
55 0.61
56 0.58
57 0.56
58 0.51
59 0.45
60 0.37
61 0.34
62 0.37
63 0.41
64 0.48
65 0.53
66 0.6
67 0.68
68 0.74
69 0.81
70 0.82
71 0.83
72 0.84
73 0.82
74 0.79
75 0.72
76 0.72
77 0.68
78 0.62
79 0.55
80 0.46
81 0.41
82 0.38
83 0.4
84 0.39
85 0.35
86 0.36
87 0.35
88 0.33
89 0.31
90 0.31
91 0.29
92 0.22
93 0.2
94 0.16
95 0.18
96 0.17
97 0.17
98 0.16
99 0.14
100 0.15
101 0.16
102 0.15
103 0.11
104 0.11
105 0.11
106 0.13
107 0.14
108 0.12
109 0.12
110 0.12
111 0.13
112 0.15
113 0.15
114 0.16
115 0.16
116 0.19
117 0.2
118 0.23
119 0.25
120 0.25
121 0.24
122 0.25
123 0.3
124 0.36
125 0.37
126 0.37
127 0.42
128 0.48
129 0.57
130 0.61
131 0.62
132 0.57
133 0.56
134 0.54
135 0.48
136 0.4
137 0.34
138 0.29
139 0.23
140 0.19
141 0.17
142 0.15
143 0.13
144 0.12
145 0.1
146 0.09
147 0.09
148 0.09
149 0.08
150 0.1
151 0.11
152 0.11
153 0.11
154 0.12
155 0.13
156 0.13
157 0.17
158 0.15
159 0.14
160 0.14
161 0.14
162 0.12
163 0.1
164 0.1
165 0.05
166 0.05
167 0.05
168 0.04
169 0.03
170 0.03
171 0.03
172 0.03
173 0.04
174 0.07
175 0.07
176 0.07
177 0.08
178 0.1
179 0.14
180 0.19
181 0.22
182 0.26
183 0.27
184 0.28
185 0.28
186 0.3
187 0.27
188 0.22
189 0.18
190 0.12
191 0.13
192 0.13
193 0.13
194 0.11
195 0.11
196 0.11
197 0.11
198 0.12
199 0.11
200 0.1
201 0.09
202 0.09
203 0.09
204 0.09
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.06
219 0.06
220 0.07
221 0.06
222 0.06
223 0.07
224 0.07
225 0.07
226 0.07
227 0.06
228 0.05
229 0.05
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.03
237 0.05
238 0.06
239 0.07
240 0.07
241 0.1
242 0.11
243 0.11
244 0.16
245 0.22
246 0.24
247 0.27
248 0.29
249 0.29
250 0.33
251 0.41
252 0.38
253 0.33
254 0.32
255 0.28
256 0.26
257 0.26
258 0.2
259 0.15
260 0.14
261 0.11
262 0.11
263 0.11
264 0.1
265 0.09
266 0.09
267 0.05
268 0.05
269 0.04
270 0.03
271 0.02
272 0.02
273 0.03
274 0.02
275 0.02
276 0.04
277 0.04
278 0.04
279 0.05
280 0.06
281 0.07
282 0.08
283 0.08
284 0.08
285 0.08
286 0.15
287 0.2
288 0.2
289 0.2
290 0.22
291 0.24
292 0.25
293 0.25
294 0.19
295 0.15
296 0.14
297 0.15
298 0.13
299 0.12
300 0.11
301 0.11
302 0.13
303 0.14
304 0.14
305 0.18
306 0.18
307 0.18
308 0.17
309 0.17
310 0.16
311 0.15
312 0.16
313 0.11
314 0.12
315 0.11
316 0.11
317 0.11
318 0.1
319 0.09
320 0.08
321 0.06
322 0.05
323 0.05
324 0.05
325 0.04
326 0.03
327 0.03
328 0.03
329 0.03
330 0.03
331 0.03
332 0.03
333 0.02
334 0.02
335 0.02
336 0.03
337 0.03
338 0.04
339 0.04
340 0.04
341 0.05
342 0.05
343 0.05
344 0.06
345 0.08
346 0.09
347 0.09
348 0.1
349 0.1
350 0.1
351 0.1
352 0.1
353 0.07
354 0.07
355 0.08
356 0.07
357 0.07
358 0.07
359 0.07
360 0.07
361 0.07
362 0.07