Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DL83

Protein Details
Accession A0A5N7DL83    Localization Confidence High Confidence Score 22.2
NoLS Segment(s)
PositionSequenceProtein Nature
57-97LKSLEKSVRYEKKHNPNSVNLQERPKKRKHASPPGSHETRLHydrophilic
356-387QDPGPTFKKKGQKRTTRRVRMKPVVSKPKRESBasic
471-527GAVEPPPTKKREKPQPQVKERQTKPRERKVNPEAHANYRSLKLRNKNSKGRGAGRFGHydrophilic
NLS Segment(s)
PositionSequence
80-90RPKKRKHASPP
363-385KKKGQKRTTRRVRMKPVVSKPKR
476-530PPTKKREKPQPQVKERQTKPRERKVNPEAHANYRSLKLRNKNSKGRGAGRFGRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021110  DNA_rep_checkpnt_protein  
IPR040203  Sld2  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006270  P:DNA replication initiation  
Pfam View protein in Pfam  
PF11719  Drc1-Sld2  
CDD cd22289  RecQL4_SLD2_NTD  
Amino Acid Sequences MASVEVSDIAAQSAQLRAELKDWERAFAAANEGRKADRSDIKQAPEIAAKYKEYSRLKSLEKSVRYEKKHNPNSVNLQERPKKRKHASPPGSHETRLESTPRKAAKGLFTTPSKQRGHPSEVDPYDSPSALRRLFSPSTHQQSSPLKTAIGPTPQRDGKALGLFDLLSESGGSTATPTAARLASVRGAAAQTPSKRRTLDTIAEEEEEEEEDSPRGDRTPASASKSYMLSALFATPTTWRYATMMDNRNDAIRREPSPQPSANDPGRGAPESETPAFLRRSNSARYAASNPTGEGLSPINVRKRPQFVGKGLSALVQGLRDMEEERLEDELDVLREIEAEQAGLNAEAIDSQTADQDPGPTFKKKGQKRTTRRVRMKPVVSKPKRESQLPVSDDEDVTDNVDQNDDELAAVPETQQPGATGDETHDVPDAASLHSISEAELDSGSDSDYEEQSKPPARSKSFSERIRDAIGAVEPPPTKKREKPQPQVKERQTKPRERKVNPEAHANYRSLKLRNKNSKGRGAGRFGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.13
4 0.14
5 0.16
6 0.23
7 0.24
8 0.31
9 0.31
10 0.31
11 0.31
12 0.3
13 0.3
14 0.25
15 0.3
16 0.24
17 0.27
18 0.27
19 0.27
20 0.28
21 0.29
22 0.31
23 0.3
24 0.35
25 0.37
26 0.45
27 0.5
28 0.53
29 0.55
30 0.53
31 0.5
32 0.47
33 0.43
34 0.38
35 0.36
36 0.34
37 0.32
38 0.35
39 0.41
40 0.41
41 0.44
42 0.46
43 0.49
44 0.52
45 0.56
46 0.61
47 0.61
48 0.6
49 0.62
50 0.65
51 0.68
52 0.7
53 0.72
54 0.73
55 0.74
56 0.79
57 0.81
58 0.76
59 0.75
60 0.78
61 0.78
62 0.76
63 0.7
64 0.7
65 0.7
66 0.74
67 0.75
68 0.73
69 0.75
70 0.74
71 0.79
72 0.8
73 0.83
74 0.84
75 0.85
76 0.86
77 0.84
78 0.81
79 0.71
80 0.62
81 0.56
82 0.49
83 0.41
84 0.38
85 0.35
86 0.35
87 0.42
88 0.43
89 0.39
90 0.39
91 0.4
92 0.42
93 0.43
94 0.43
95 0.41
96 0.42
97 0.45
98 0.49
99 0.54
100 0.49
101 0.46
102 0.5
103 0.5
104 0.53
105 0.53
106 0.51
107 0.52
108 0.5
109 0.52
110 0.44
111 0.41
112 0.36
113 0.3
114 0.27
115 0.2
116 0.25
117 0.21
118 0.21
119 0.19
120 0.24
121 0.27
122 0.28
123 0.32
124 0.35
125 0.42
126 0.44
127 0.43
128 0.42
129 0.47
130 0.5
131 0.47
132 0.4
133 0.32
134 0.3
135 0.33
136 0.31
137 0.32
138 0.31
139 0.28
140 0.34
141 0.36
142 0.36
143 0.34
144 0.32
145 0.28
146 0.28
147 0.26
148 0.19
149 0.18
150 0.17
151 0.15
152 0.14
153 0.09
154 0.06
155 0.05
156 0.05
157 0.04
158 0.05
159 0.04
160 0.04
161 0.05
162 0.05
163 0.05
164 0.06
165 0.07
166 0.07
167 0.08
168 0.08
169 0.09
170 0.1
171 0.1
172 0.1
173 0.09
174 0.09
175 0.09
176 0.11
177 0.14
178 0.17
179 0.24
180 0.26
181 0.29
182 0.3
183 0.31
184 0.34
185 0.35
186 0.37
187 0.33
188 0.35
189 0.32
190 0.32
191 0.31
192 0.26
193 0.2
194 0.14
195 0.11
196 0.08
197 0.07
198 0.06
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.07
205 0.09
206 0.16
207 0.19
208 0.24
209 0.25
210 0.26
211 0.27
212 0.27
213 0.24
214 0.19
215 0.16
216 0.11
217 0.1
218 0.09
219 0.08
220 0.07
221 0.07
222 0.07
223 0.08
224 0.09
225 0.09
226 0.09
227 0.1
228 0.12
229 0.15
230 0.23
231 0.29
232 0.28
233 0.29
234 0.29
235 0.3
236 0.29
237 0.26
238 0.22
239 0.18
240 0.2
241 0.23
242 0.27
243 0.29
244 0.33
245 0.35
246 0.33
247 0.32
248 0.36
249 0.32
250 0.3
251 0.26
252 0.22
253 0.22
254 0.2
255 0.18
256 0.13
257 0.14
258 0.15
259 0.15
260 0.14
261 0.13
262 0.16
263 0.17
264 0.17
265 0.17
266 0.17
267 0.21
268 0.23
269 0.25
270 0.25
271 0.24
272 0.26
273 0.28
274 0.27
275 0.26
276 0.23
277 0.2
278 0.17
279 0.16
280 0.13
281 0.11
282 0.09
283 0.08
284 0.1
285 0.12
286 0.17
287 0.19
288 0.21
289 0.25
290 0.29
291 0.31
292 0.36
293 0.4
294 0.38
295 0.41
296 0.39
297 0.35
298 0.31
299 0.28
300 0.21
301 0.15
302 0.12
303 0.07
304 0.07
305 0.06
306 0.06
307 0.06
308 0.07
309 0.07
310 0.07
311 0.08
312 0.08
313 0.09
314 0.08
315 0.08
316 0.07
317 0.08
318 0.07
319 0.07
320 0.07
321 0.06
322 0.06
323 0.06
324 0.06
325 0.05
326 0.05
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.03
333 0.03
334 0.03
335 0.04
336 0.04
337 0.04
338 0.04
339 0.05
340 0.06
341 0.06
342 0.07
343 0.09
344 0.1
345 0.13
346 0.17
347 0.18
348 0.2
349 0.26
350 0.35
351 0.4
352 0.51
353 0.57
354 0.65
355 0.73
356 0.83
357 0.87
358 0.89
359 0.92
360 0.91
361 0.91
362 0.89
363 0.88
364 0.86
365 0.86
366 0.86
367 0.82
368 0.81
369 0.76
370 0.76
371 0.71
372 0.64
373 0.6
374 0.57
375 0.61
376 0.53
377 0.5
378 0.43
379 0.4
380 0.37
381 0.32
382 0.25
383 0.15
384 0.15
385 0.13
386 0.12
387 0.11
388 0.11
389 0.1
390 0.09
391 0.09
392 0.07
393 0.07
394 0.07
395 0.07
396 0.07
397 0.07
398 0.07
399 0.1
400 0.11
401 0.11
402 0.1
403 0.1
404 0.11
405 0.13
406 0.13
407 0.1
408 0.11
409 0.14
410 0.14
411 0.14
412 0.13
413 0.11
414 0.1
415 0.12
416 0.12
417 0.09
418 0.1
419 0.09
420 0.09
421 0.09
422 0.09
423 0.07
424 0.08
425 0.08
426 0.07
427 0.07
428 0.07
429 0.07
430 0.08
431 0.08
432 0.06
433 0.07
434 0.08
435 0.1
436 0.13
437 0.13
438 0.15
439 0.2
440 0.27
441 0.29
442 0.35
443 0.42
444 0.44
445 0.47
446 0.54
447 0.59
448 0.62
449 0.65
450 0.65
451 0.6
452 0.59
453 0.58
454 0.51
455 0.4
456 0.33
457 0.28
458 0.22
459 0.19
460 0.21
461 0.19
462 0.23
463 0.28
464 0.3
465 0.36
466 0.42
467 0.53
468 0.58
469 0.68
470 0.75
471 0.81
472 0.87
473 0.91
474 0.93
475 0.93
476 0.92
477 0.88
478 0.88
479 0.87
480 0.87
481 0.88
482 0.87
483 0.88
484 0.82
485 0.86
486 0.85
487 0.85
488 0.77
489 0.77
490 0.72
491 0.69
492 0.68
493 0.59
494 0.52
495 0.49
496 0.52
497 0.48
498 0.52
499 0.54
500 0.61
501 0.7
502 0.76
503 0.8
504 0.83
505 0.86
506 0.85
507 0.84
508 0.81
509 0.79
510 0.79