Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CU63

Protein Details
Accession A0A5N7CU63   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40FNCRYIPSRCGQRPPKNPPKPDSVSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 6.5, cyto_mito 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001248  Pur-cyt_permease  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF02133  Transp_cyt_pur  
Amino Acid Sequences MQFRLSAVLAVFVRGFNCRYIPSRCGQRPPKNPPKPDSVSQYISTFAIQTPRSSFLSATPNTAPPLSLADTPTPGEVSQPVNLAPGPASTTSPLTSFPTTATTSSRVHYNERLVKYYISKFHPVHPILLPHSLYATQGYPDYLQVVVQFVGSHYASSSYWFEGRFNWRAFEAWLVGFAPSIPGLAALNPHNTGIPIGLTYTFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.16
5 0.18
6 0.23
7 0.28
8 0.31
9 0.35
10 0.45
11 0.49
12 0.57
13 0.64
14 0.7
15 0.75
16 0.82
17 0.86
18 0.85
19 0.87
20 0.81
21 0.8
22 0.76
23 0.72
24 0.69
25 0.64
26 0.58
27 0.53
28 0.49
29 0.41
30 0.34
31 0.28
32 0.21
33 0.16
34 0.17
35 0.15
36 0.16
37 0.18
38 0.21
39 0.22
40 0.22
41 0.22
42 0.2
43 0.27
44 0.26
45 0.27
46 0.25
47 0.25
48 0.25
49 0.25
50 0.21
51 0.14
52 0.16
53 0.14
54 0.14
55 0.14
56 0.13
57 0.15
58 0.15
59 0.15
60 0.12
61 0.1
62 0.1
63 0.1
64 0.11
65 0.11
66 0.11
67 0.1
68 0.11
69 0.1
70 0.1
71 0.08
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.1
81 0.12
82 0.12
83 0.12
84 0.11
85 0.13
86 0.14
87 0.14
88 0.14
89 0.15
90 0.15
91 0.16
92 0.19
93 0.18
94 0.2
95 0.22
96 0.27
97 0.3
98 0.31
99 0.33
100 0.3
101 0.3
102 0.31
103 0.32
104 0.3
105 0.27
106 0.32
107 0.3
108 0.34
109 0.41
110 0.39
111 0.38
112 0.34
113 0.33
114 0.29
115 0.31
116 0.26
117 0.18
118 0.18
119 0.16
120 0.14
121 0.13
122 0.11
123 0.08
124 0.08
125 0.09
126 0.09
127 0.09
128 0.09
129 0.08
130 0.08
131 0.07
132 0.08
133 0.07
134 0.07
135 0.07
136 0.06
137 0.09
138 0.09
139 0.09
140 0.08
141 0.09
142 0.09
143 0.12
144 0.14
145 0.13
146 0.14
147 0.15
148 0.15
149 0.19
150 0.26
151 0.29
152 0.29
153 0.29
154 0.28
155 0.28
156 0.29
157 0.26
158 0.22
159 0.15
160 0.15
161 0.14
162 0.13
163 0.12
164 0.11
165 0.09
166 0.07
167 0.07
168 0.06
169 0.06
170 0.06
171 0.07
172 0.1
173 0.11
174 0.15
175 0.15
176 0.16
177 0.16
178 0.16
179 0.16
180 0.13
181 0.12
182 0.09
183 0.1
184 0.1