Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6I6J0

Protein Details
Accession A0A5N6I6J0    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-110LRSKRDTKIKRHFERWVRQQAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF08613  Cyclin  
Amino Acid Sequences MAGSTAVTPIRTSTTHYNRDCMLHHTFLQDLMETNTHKRVQMLPTLTSDKRPVRQIVDLRQKDTKTATLSPCRNSYCGSHCELNSNGLLRSKRDTKIKRHFERWVRQQAEWCSDSHATAPRSMSSSIAGSIAGTDEGAENVIPLSTVLLPDPYSQRLPWRYELVNPMLMVQLISNTLGRLAFLNDMAFRPRFTVTRFHSNRAPRISACEYLRRLTHRLCLSSPTLVMMVIYIRQLCKTHPTFDVSSLTAHRLLLSCALVASKSVSDFAWPNQSFASAGGVSAAEMAVLELELLEYLEWNVAPHQERLSECYRDLVQGSNGYSAEHGTSSAGPYAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.47
3 0.48
4 0.51
5 0.5
6 0.52
7 0.49
8 0.44
9 0.4
10 0.35
11 0.34
12 0.33
13 0.3
14 0.28
15 0.27
16 0.22
17 0.17
18 0.16
19 0.18
20 0.18
21 0.21
22 0.26
23 0.27
24 0.27
25 0.28
26 0.31
27 0.32
28 0.38
29 0.39
30 0.35
31 0.38
32 0.44
33 0.43
34 0.41
35 0.44
36 0.42
37 0.43
38 0.47
39 0.46
40 0.44
41 0.52
42 0.55
43 0.58
44 0.63
45 0.62
46 0.6
47 0.61
48 0.57
49 0.52
50 0.47
51 0.42
52 0.36
53 0.39
54 0.42
55 0.45
56 0.5
57 0.51
58 0.54
59 0.52
60 0.48
61 0.43
62 0.4
63 0.36
64 0.35
65 0.36
66 0.34
67 0.32
68 0.35
69 0.34
70 0.32
71 0.27
72 0.25
73 0.22
74 0.22
75 0.23
76 0.21
77 0.26
78 0.3
79 0.33
80 0.42
81 0.49
82 0.54
83 0.64
84 0.73
85 0.75
86 0.76
87 0.8
88 0.8
89 0.82
90 0.81
91 0.81
92 0.74
93 0.67
94 0.67
95 0.62
96 0.58
97 0.48
98 0.39
99 0.32
100 0.29
101 0.28
102 0.24
103 0.25
104 0.2
105 0.22
106 0.22
107 0.19
108 0.21
109 0.21
110 0.19
111 0.14
112 0.13
113 0.11
114 0.11
115 0.09
116 0.07
117 0.06
118 0.06
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.08
138 0.09
139 0.11
140 0.12
141 0.12
142 0.18
143 0.22
144 0.24
145 0.25
146 0.28
147 0.26
148 0.28
149 0.31
150 0.28
151 0.25
152 0.22
153 0.19
154 0.15
155 0.14
156 0.12
157 0.08
158 0.06
159 0.04
160 0.05
161 0.04
162 0.04
163 0.05
164 0.04
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.1
174 0.1
175 0.09
176 0.1
177 0.12
178 0.13
179 0.14
180 0.22
181 0.24
182 0.35
183 0.37
184 0.39
185 0.44
186 0.48
187 0.52
188 0.49
189 0.47
190 0.36
191 0.4
192 0.41
193 0.39
194 0.36
195 0.36
196 0.34
197 0.33
198 0.36
199 0.33
200 0.33
201 0.3
202 0.35
203 0.32
204 0.33
205 0.31
206 0.32
207 0.3
208 0.28
209 0.26
210 0.2
211 0.16
212 0.13
213 0.12
214 0.08
215 0.07
216 0.06
217 0.07
218 0.07
219 0.07
220 0.09
221 0.1
222 0.11
223 0.19
224 0.21
225 0.24
226 0.26
227 0.31
228 0.3
229 0.33
230 0.35
231 0.27
232 0.26
233 0.24
234 0.23
235 0.19
236 0.17
237 0.15
238 0.13
239 0.13
240 0.13
241 0.12
242 0.1
243 0.09
244 0.1
245 0.08
246 0.08
247 0.09
248 0.08
249 0.08
250 0.09
251 0.08
252 0.1
253 0.12
254 0.14
255 0.23
256 0.23
257 0.23
258 0.23
259 0.23
260 0.21
261 0.2
262 0.22
263 0.11
264 0.1
265 0.1
266 0.1
267 0.09
268 0.09
269 0.08
270 0.04
271 0.04
272 0.04
273 0.03
274 0.03
275 0.03
276 0.02
277 0.03
278 0.03
279 0.03
280 0.03
281 0.04
282 0.04
283 0.05
284 0.05
285 0.06
286 0.07
287 0.12
288 0.15
289 0.17
290 0.18
291 0.22
292 0.23
293 0.28
294 0.33
295 0.32
296 0.3
297 0.32
298 0.32
299 0.3
300 0.3
301 0.28
302 0.25
303 0.26
304 0.27
305 0.26
306 0.25
307 0.23
308 0.22
309 0.2
310 0.17
311 0.13
312 0.12
313 0.11
314 0.12
315 0.13