Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MAN2

Protein Details
Accession C5MAN2    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-81EESKKRPSDQSSEKKKKKRRRRNYDEEDEALBasic
NLS Segment(s)
PositionSequence
53-72SKKRPSDQSSEKKKKKRRRR
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG ctp:CTRG_03124  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSEPIESKEEKVEEPVAEVTATEESESTEQEKQQQQTEKEEDGKEEEGKEEESKKRPSDQSSEKKKKKRRRRNYDEEDEALEKEEEKEKEAKVGATGVGAVDDDDEDEDEDEDYEQGKLDDEDEEDDELLEIDESNIITTGRRTRGKVIDFAKAAEKLDKESGVLAEEEEEDEEEGEFKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.2
4 0.17
5 0.16
6 0.14
7 0.12
8 0.11
9 0.09
10 0.08
11 0.09
12 0.1
13 0.11
14 0.13
15 0.14
16 0.15
17 0.23
18 0.29
19 0.29
20 0.36
21 0.42
22 0.42
23 0.47
24 0.51
25 0.48
26 0.47
27 0.45
28 0.4
29 0.35
30 0.35
31 0.29
32 0.25
33 0.22
34 0.18
35 0.19
36 0.2
37 0.22
38 0.26
39 0.31
40 0.36
41 0.37
42 0.43
43 0.46
44 0.48
45 0.5
46 0.55
47 0.59
48 0.65
49 0.74
50 0.76
51 0.81
52 0.86
53 0.88
54 0.89
55 0.9
56 0.9
57 0.9
58 0.92
59 0.94
60 0.93
61 0.91
62 0.85
63 0.75
64 0.66
65 0.56
66 0.45
67 0.35
68 0.25
69 0.16
70 0.12
71 0.15
72 0.13
73 0.14
74 0.16
75 0.15
76 0.17
77 0.18
78 0.16
79 0.12
80 0.12
81 0.1
82 0.07
83 0.07
84 0.05
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.06
109 0.08
110 0.09
111 0.09
112 0.09
113 0.09
114 0.08
115 0.07
116 0.07
117 0.05
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.06
126 0.09
127 0.15
128 0.21
129 0.26
130 0.28
131 0.35
132 0.43
133 0.45
134 0.5
135 0.48
136 0.48
137 0.45
138 0.44
139 0.42
140 0.36
141 0.34
142 0.3
143 0.28
144 0.24
145 0.27
146 0.25
147 0.21
148 0.21
149 0.2
150 0.17
151 0.17
152 0.13
153 0.11
154 0.11
155 0.11
156 0.1
157 0.1
158 0.09
159 0.09
160 0.09