Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MFQ2

Protein Details
Accession C5MFQ2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
142-200LSIPAKKKQKQAQSPKKKTKDNKIKKEPIKSKPKPKSKAKPKAKPEPKPKPKPVVVNEYBasic
NLS Segment(s)
PositionSequence
146-193AKKKQKQAQSPKKKTKDNKIKKEPIKSKPKPKSKAKPKAKPEPKPKPK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR035503  IOC4-like_PWWP  
IPR000313  PWWP_dom  
KEGG ctp:CTRG_04895  -  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05840  PWWP_ScIOC4-like  
Amino Acid Sequences MSTSPVSYQPTNIVLAKVKGYPAWPAMVLEESLLPPHILSKQPKSSKSTTTSTTTTTTTVKKIVPVRFFSDDTYIWININDIKPLTKEDIQNYFKKSNSKRKIDLLLNTAYELANDPPDMEQFIKYGSKGVPEESSEDDEVLSIPAKKKQKQAQSPKKKTKDNKIKKEPIKSKPKPKSKAKPKAKPEPKPKPKPVVVNEYDDDWGLDDFNKYDKSTGNYIYETEAEQQKVFKSIRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.26
4 0.24
5 0.23
6 0.21
7 0.21
8 0.22
9 0.21
10 0.21
11 0.19
12 0.18
13 0.18
14 0.18
15 0.17
16 0.13
17 0.12
18 0.1
19 0.11
20 0.11
21 0.09
22 0.08
23 0.1
24 0.13
25 0.18
26 0.24
27 0.32
28 0.41
29 0.48
30 0.53
31 0.58
32 0.59
33 0.6
34 0.59
35 0.56
36 0.5
37 0.48
38 0.45
39 0.41
40 0.39
41 0.33
42 0.29
43 0.28
44 0.26
45 0.23
46 0.25
47 0.23
48 0.26
49 0.32
50 0.37
51 0.39
52 0.4
53 0.44
54 0.44
55 0.45
56 0.4
57 0.37
58 0.3
59 0.28
60 0.27
61 0.21
62 0.17
63 0.16
64 0.15
65 0.15
66 0.16
67 0.14
68 0.11
69 0.12
70 0.13
71 0.15
72 0.18
73 0.18
74 0.2
75 0.23
76 0.32
77 0.35
78 0.38
79 0.41
80 0.4
81 0.38
82 0.44
83 0.48
84 0.5
85 0.55
86 0.58
87 0.57
88 0.59
89 0.64
90 0.6
91 0.56
92 0.48
93 0.41
94 0.35
95 0.31
96 0.26
97 0.19
98 0.14
99 0.12
100 0.08
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.07
107 0.07
108 0.07
109 0.06
110 0.08
111 0.08
112 0.08
113 0.1
114 0.09
115 0.11
116 0.12
117 0.13
118 0.13
119 0.13
120 0.15
121 0.15
122 0.18
123 0.15
124 0.14
125 0.13
126 0.11
127 0.11
128 0.09
129 0.08
130 0.07
131 0.08
132 0.15
133 0.22
134 0.26
135 0.34
136 0.41
137 0.5
138 0.59
139 0.69
140 0.75
141 0.8
142 0.86
143 0.89
144 0.9
145 0.89
146 0.87
147 0.87
148 0.87
149 0.87
150 0.87
151 0.87
152 0.89
153 0.87
154 0.9
155 0.88
156 0.87
157 0.87
158 0.85
159 0.85
160 0.85
161 0.88
162 0.87
163 0.88
164 0.89
165 0.89
166 0.91
167 0.91
168 0.91
169 0.91
170 0.92
171 0.92
172 0.91
173 0.91
174 0.91
175 0.91
176 0.92
177 0.91
178 0.9
179 0.86
180 0.85
181 0.81
182 0.8
183 0.72
184 0.68
185 0.6
186 0.52
187 0.46
188 0.36
189 0.29
190 0.2
191 0.16
192 0.11
193 0.1
194 0.09
195 0.09
196 0.13
197 0.15
198 0.15
199 0.17
200 0.2
201 0.24
202 0.28
203 0.32
204 0.32
205 0.3
206 0.31
207 0.31
208 0.29
209 0.26
210 0.26
211 0.27
212 0.25
213 0.25
214 0.26
215 0.25
216 0.31