Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q750I4

Protein Details
Accession Q750I4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
142-167GAGASSTKKPRRKLRPKKALIKLSPDHydrophilic
NLS Segment(s)
PositionSequence
148-160TKKPRRKLRPKKA
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000361  FeS_biogenesis  
IPR016092  FeS_cluster_insertion  
IPR017870  FeS_cluster_insertion_CS  
IPR035903  HesB-like_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005759  C:mitochondrial matrix  
GO:0005739  C:mitochondrion  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0005506  F:iron ion binding  
GO:0009102  P:biotin biosynthetic process  
GO:0016226  P:iron-sulfur cluster assembly  
GO:0106035  P:protein maturation by [4Fe-4S] cluster transfer  
GO:0097428  P:protein maturation by iron-sulfur cluster transfer  
KEGG ago:AGOS_AGL033C  -  
Pfam View protein in Pfam  
PF01521  Fe-S_biosyn  
PROSITE View protein in PROSITE  
PS01152  HESB  
Amino Acid Sequences MMVYYYLSKVPAASHRRMGAVLCRTAALLGKRTTTIDNKRQLQLHSQQTKSKTYEKPAVPRGWSFDSQPVGSSGASHDSSEAKGDEHPRTKWASYSLSRSDAPQGHHAGSDAAAHVTKRSDSATNKEVRSHAAAPAAANATGAGASSTKKPRRKLRPKKALIKLSPDALVHLKALLDQPEPQLIRIGVRNRGCSGLTYDLQYIKEPGEFDEVIEQDGVKVVIDSKALFSIVGSEMDWIDDKLSSRFVFKNPNSKGTCGCGESFMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.41
5 0.39
6 0.38
7 0.38
8 0.35
9 0.29
10 0.27
11 0.26
12 0.26
13 0.28
14 0.23
15 0.23
16 0.23
17 0.24
18 0.25
19 0.27
20 0.31
21 0.35
22 0.42
23 0.44
24 0.52
25 0.55
26 0.59
27 0.61
28 0.59
29 0.58
30 0.57
31 0.59
32 0.58
33 0.57
34 0.57
35 0.57
36 0.61
37 0.57
38 0.57
39 0.52
40 0.51
41 0.56
42 0.57
43 0.61
44 0.63
45 0.64
46 0.59
47 0.55
48 0.53
49 0.49
50 0.45
51 0.38
52 0.36
53 0.33
54 0.3
55 0.29
56 0.24
57 0.2
58 0.18
59 0.16
60 0.12
61 0.13
62 0.14
63 0.13
64 0.13
65 0.12
66 0.13
67 0.14
68 0.13
69 0.1
70 0.13
71 0.18
72 0.23
73 0.27
74 0.27
75 0.29
76 0.32
77 0.32
78 0.3
79 0.29
80 0.29
81 0.28
82 0.33
83 0.33
84 0.32
85 0.32
86 0.31
87 0.33
88 0.3
89 0.29
90 0.28
91 0.27
92 0.24
93 0.24
94 0.23
95 0.18
96 0.15
97 0.13
98 0.08
99 0.06
100 0.06
101 0.06
102 0.07
103 0.07
104 0.07
105 0.07
106 0.09
107 0.13
108 0.15
109 0.2
110 0.25
111 0.3
112 0.31
113 0.32
114 0.31
115 0.28
116 0.29
117 0.25
118 0.2
119 0.16
120 0.16
121 0.14
122 0.15
123 0.13
124 0.09
125 0.08
126 0.06
127 0.05
128 0.05
129 0.04
130 0.03
131 0.03
132 0.04
133 0.09
134 0.18
135 0.25
136 0.31
137 0.39
138 0.49
139 0.6
140 0.71
141 0.78
142 0.81
143 0.85
144 0.89
145 0.92
146 0.91
147 0.89
148 0.81
149 0.77
150 0.68
151 0.58
152 0.51
153 0.4
154 0.33
155 0.24
156 0.22
157 0.14
158 0.12
159 0.1
160 0.09
161 0.11
162 0.11
163 0.1
164 0.11
165 0.12
166 0.17
167 0.17
168 0.17
169 0.17
170 0.16
171 0.17
172 0.21
173 0.23
174 0.26
175 0.29
176 0.31
177 0.3
178 0.32
179 0.3
180 0.26
181 0.27
182 0.25
183 0.22
184 0.22
185 0.23
186 0.23
187 0.24
188 0.23
189 0.2
190 0.15
191 0.16
192 0.14
193 0.14
194 0.17
195 0.16
196 0.16
197 0.2
198 0.19
199 0.18
200 0.17
201 0.16
202 0.1
203 0.11
204 0.11
205 0.06
206 0.06
207 0.06
208 0.07
209 0.09
210 0.09
211 0.09
212 0.1
213 0.1
214 0.1
215 0.09
216 0.1
217 0.11
218 0.11
219 0.1
220 0.1
221 0.1
222 0.11
223 0.12
224 0.09
225 0.09
226 0.1
227 0.11
228 0.12
229 0.17
230 0.16
231 0.2
232 0.23
233 0.27
234 0.36
235 0.4
236 0.49
237 0.49
238 0.58
239 0.58
240 0.58
241 0.57
242 0.52
243 0.51
244 0.44
245 0.4