Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M9W3

Protein Details
Accession C5M9W3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-68NKLNKIKSMKTSKKSKQNNKLHGNKGIHydrophilic
NLS Segment(s)
PositionSequence
54-56KKS
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019446  BMT5-like  
Gene Ontology GO:0070042  F:rRNA (uridine-N3-)-methyltransferase activity  
GO:0070475  P:rRNA base methylation  
KEGG ctp:CTRG_02275  -  
Pfam View protein in Pfam  
PF10354  BMT5-like  
Amino Acid Sequences MGRKLKGKSIQSKGLKGALIRHQTKEQTQAKLLKNAEISNENKLNKIKSMKTSKKSKQNNKLHGNKGISKGLMPFLNEDKVLLIGEGDFTFAKSLILQNYLIPENLIATSFDSYEELILKYPNVDEVLKELKEFGVKIIHQVDATNLPLTLKLIQNSKQKKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.54
3 0.46
4 0.45
5 0.44
6 0.47
7 0.45
8 0.46
9 0.47
10 0.5
11 0.51
12 0.54
13 0.52
14 0.47
15 0.5
16 0.54
17 0.52
18 0.56
19 0.54
20 0.48
21 0.44
22 0.4
23 0.37
24 0.34
25 0.32
26 0.31
27 0.36
28 0.33
29 0.34
30 0.35
31 0.34
32 0.34
33 0.38
34 0.35
35 0.38
36 0.49
37 0.54
38 0.6
39 0.69
40 0.71
41 0.76
42 0.82
43 0.84
44 0.84
45 0.85
46 0.87
47 0.86
48 0.87
49 0.81
50 0.78
51 0.72
52 0.65
53 0.59
54 0.5
55 0.4
56 0.32
57 0.28
58 0.23
59 0.19
60 0.15
61 0.13
62 0.13
63 0.14
64 0.13
65 0.12
66 0.1
67 0.09
68 0.09
69 0.06
70 0.05
71 0.03
72 0.04
73 0.04
74 0.05
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.07
82 0.07
83 0.09
84 0.09
85 0.09
86 0.11
87 0.12
88 0.11
89 0.1
90 0.09
91 0.08
92 0.08
93 0.08
94 0.06
95 0.06
96 0.07
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.08
103 0.07
104 0.08
105 0.08
106 0.08
107 0.08
108 0.08
109 0.09
110 0.1
111 0.1
112 0.09
113 0.14
114 0.19
115 0.19
116 0.19
117 0.18
118 0.16
119 0.18
120 0.18
121 0.15
122 0.16
123 0.16
124 0.21
125 0.23
126 0.23
127 0.21
128 0.21
129 0.22
130 0.19
131 0.21
132 0.17
133 0.15
134 0.14
135 0.14
136 0.16
137 0.17
138 0.17
139 0.19
140 0.24
141 0.32
142 0.42
143 0.5