Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MJH5

Protein Details
Accession C5MJH5    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
10-33FITPQTPPRSQRRRSNPNATPLQSHydrophilic
200-227LINNRTGKKRIVKLTKNQMKIKPKKLSFHydrophilic
NLS Segment(s)
PositionSequence
207-223KKRIVKLTKNQMKIKPK
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
KEGG ctp:CTRG_06218  -  
Amino Acid Sequences MSSSDSPSIFITPQTPPRSQRRRSNPNATPLQSNHLLTPSTVSKKQQKSPVTTRRKQDTISTSKFPFTPATPQKSPCKSKKNLDLFTSNEKFGILLPSPSTIGSGRCHNSIIHGPPPVFDMKKFTPFKVPATPRKQIVDEPKLPVSDSDEDDWEVSTMSEVDKIPRAKLTNPFIDNGEHKTAPSQSLSPNGINYDTHMELINNRTGKKRIVKLTKNQMKIKPKKLSFDGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.43
4 0.53
5 0.62
6 0.68
7 0.72
8 0.75
9 0.8
10 0.84
11 0.88
12 0.84
13 0.84
14 0.84
15 0.76
16 0.71
17 0.62
18 0.58
19 0.52
20 0.46
21 0.37
22 0.3
23 0.28
24 0.22
25 0.24
26 0.25
27 0.26
28 0.29
29 0.34
30 0.41
31 0.48
32 0.55
33 0.6
34 0.6
35 0.63
36 0.71
37 0.75
38 0.76
39 0.76
40 0.77
41 0.76
42 0.73
43 0.66
44 0.63
45 0.62
46 0.61
47 0.6
48 0.56
49 0.49
50 0.48
51 0.46
52 0.4
53 0.33
54 0.25
55 0.3
56 0.33
57 0.39
58 0.41
59 0.45
60 0.52
61 0.59
62 0.65
63 0.64
64 0.65
65 0.64
66 0.69
67 0.75
68 0.76
69 0.72
70 0.68
71 0.63
72 0.57
73 0.6
74 0.53
75 0.43
76 0.33
77 0.28
78 0.24
79 0.2
80 0.19
81 0.11
82 0.09
83 0.1
84 0.1
85 0.11
86 0.11
87 0.11
88 0.08
89 0.1
90 0.11
91 0.15
92 0.15
93 0.16
94 0.17
95 0.15
96 0.17
97 0.19
98 0.21
99 0.19
100 0.19
101 0.18
102 0.17
103 0.19
104 0.19
105 0.16
106 0.13
107 0.17
108 0.17
109 0.26
110 0.28
111 0.27
112 0.32
113 0.34
114 0.37
115 0.4
116 0.45
117 0.45
118 0.51
119 0.54
120 0.49
121 0.49
122 0.47
123 0.44
124 0.46
125 0.45
126 0.41
127 0.41
128 0.4
129 0.38
130 0.36
131 0.31
132 0.26
133 0.21
134 0.2
135 0.17
136 0.16
137 0.17
138 0.17
139 0.16
140 0.12
141 0.09
142 0.07
143 0.06
144 0.05
145 0.05
146 0.07
147 0.07
148 0.09
149 0.15
150 0.16
151 0.17
152 0.21
153 0.23
154 0.25
155 0.33
156 0.38
157 0.4
158 0.4
159 0.4
160 0.37
161 0.38
162 0.36
163 0.33
164 0.32
165 0.24
166 0.23
167 0.25
168 0.25
169 0.24
170 0.24
171 0.21
172 0.18
173 0.24
174 0.27
175 0.26
176 0.25
177 0.25
178 0.24
179 0.22
180 0.22
181 0.21
182 0.19
183 0.18
184 0.17
185 0.16
186 0.18
187 0.22
188 0.26
189 0.23
190 0.24
191 0.29
192 0.32
193 0.39
194 0.45
195 0.5
196 0.54
197 0.62
198 0.69
199 0.74
200 0.83
201 0.84
202 0.84
203 0.84
204 0.83
205 0.83
206 0.84
207 0.84
208 0.84
209 0.8
210 0.8