Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MEL7

Protein Details
Accession C5MEL7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-54IKPTTRIERSGEKKKKKKKIEKNNQDCLVNHydrophilic
NLS Segment(s)
PositionSequence
32-45ERSGEKKKKKKKIE
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR021151  GINS_A  
IPR036224  GINS_bundle-like_dom_sf  
IPR007257  GINS_Psf2  
Gene Ontology GO:0071162  C:CMG complex  
GO:0000811  C:GINS complex  
GO:0031298  C:replication fork protection complex  
GO:0006268  P:DNA unwinding involved in DNA replication  
GO:0000727  P:double-strand break repair via break-induced replication  
KEGG ctp:CTRG_04510  -  
Pfam View protein in Pfam  
PF05916  Sld5  
CDD cd11712  GINS_A_psf2  
cd21694  GINS_B_Psf2  
Amino Acid Sequences MYNYNFCFEIQRSKHVLVVFMLSAIKPTTRIERSGEKKKKKKKIEKNNQDCLVNVIASRDINDMVLPSSLQGNFPPSEITFFAENELITVLPRYSIKKIDLIGTRIPNLRAMRREQVPLWVALILKSQDKCSIVPPKWLNVAFLKEKYDDEVRKPLQFSDLPWNWLEVSKILLDKASDDLSDPVDQLRSVIQDLREVRLVKTKKGFKELNESNIQLNGLSLLEINEIRPFVIPVMNKLRRLHETTQSNYSQAQDEEMEDVSDEEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.4
4 0.31
5 0.31
6 0.23
7 0.19
8 0.18
9 0.14
10 0.15
11 0.13
12 0.13
13 0.11
14 0.14
15 0.21
16 0.23
17 0.27
18 0.3
19 0.4
20 0.48
21 0.58
22 0.66
23 0.68
24 0.75
25 0.83
26 0.88
27 0.9
28 0.92
29 0.92
30 0.93
31 0.94
32 0.95
33 0.95
34 0.94
35 0.88
36 0.78
37 0.67
38 0.58
39 0.49
40 0.38
41 0.27
42 0.18
43 0.15
44 0.14
45 0.15
46 0.12
47 0.11
48 0.1
49 0.1
50 0.09
51 0.08
52 0.09
53 0.07
54 0.06
55 0.09
56 0.09
57 0.1
58 0.1
59 0.12
60 0.12
61 0.13
62 0.14
63 0.12
64 0.14
65 0.14
66 0.16
67 0.14
68 0.13
69 0.14
70 0.13
71 0.13
72 0.1
73 0.1
74 0.07
75 0.06
76 0.07
77 0.05
78 0.06
79 0.08
80 0.1
81 0.12
82 0.16
83 0.17
84 0.19
85 0.2
86 0.25
87 0.27
88 0.27
89 0.3
90 0.28
91 0.3
92 0.28
93 0.28
94 0.27
95 0.27
96 0.27
97 0.26
98 0.28
99 0.31
100 0.32
101 0.34
102 0.29
103 0.31
104 0.28
105 0.25
106 0.21
107 0.17
108 0.14
109 0.12
110 0.13
111 0.09
112 0.11
113 0.11
114 0.12
115 0.13
116 0.14
117 0.14
118 0.18
119 0.26
120 0.24
121 0.32
122 0.32
123 0.31
124 0.34
125 0.34
126 0.31
127 0.24
128 0.28
129 0.22
130 0.22
131 0.22
132 0.19
133 0.19
134 0.2
135 0.24
136 0.22
137 0.22
138 0.3
139 0.3
140 0.31
141 0.32
142 0.29
143 0.27
144 0.26
145 0.25
146 0.27
147 0.26
148 0.26
149 0.26
150 0.26
151 0.22
152 0.22
153 0.2
154 0.1
155 0.1
156 0.1
157 0.1
158 0.09
159 0.09
160 0.09
161 0.09
162 0.1
163 0.1
164 0.08
165 0.09
166 0.1
167 0.11
168 0.12
169 0.11
170 0.1
171 0.1
172 0.09
173 0.09
174 0.09
175 0.08
176 0.09
177 0.12
178 0.12
179 0.17
180 0.19
181 0.21
182 0.24
183 0.24
184 0.24
185 0.31
186 0.32
187 0.32
188 0.4
189 0.45
190 0.45
191 0.52
192 0.55
193 0.49
194 0.58
195 0.57
196 0.55
197 0.52
198 0.49
199 0.42
200 0.39
201 0.36
202 0.25
203 0.2
204 0.14
205 0.09
206 0.07
207 0.06
208 0.06
209 0.08
210 0.08
211 0.09
212 0.09
213 0.1
214 0.1
215 0.1
216 0.1
217 0.1
218 0.14
219 0.14
220 0.19
221 0.3
222 0.35
223 0.4
224 0.42
225 0.47
226 0.49
227 0.55
228 0.54
229 0.53
230 0.55
231 0.55
232 0.6
233 0.55
234 0.51
235 0.46
236 0.42
237 0.36
238 0.29
239 0.26
240 0.2
241 0.19
242 0.19
243 0.18
244 0.16
245 0.13