Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DE26

Protein Details
Accession A0A5N7DE26    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-64TPSQTPSMPKKKKNTYTQPKHSSDKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.499, nucl 12, mito 11.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MPHWQRHANLYIHYSTTRTHSSQPQEKSTRRKLIHSALTPSQTPSMPKKKKNTYTQPKHSSDKLIPAHPNPIFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.23
3 0.24
4 0.25
5 0.23
6 0.26
7 0.31
8 0.39
9 0.45
10 0.49
11 0.53
12 0.57
13 0.61
14 0.66
15 0.68
16 0.68
17 0.62
18 0.61
19 0.58
20 0.57
21 0.58
22 0.52
23 0.47
24 0.4
25 0.4
26 0.37
27 0.32
28 0.26
29 0.19
30 0.2
31 0.24
32 0.32
33 0.38
34 0.46
35 0.54
36 0.63
37 0.72
38 0.79
39 0.82
40 0.83
41 0.86
42 0.89
43 0.89
44 0.85
45 0.81
46 0.74
47 0.7
48 0.61
49 0.6
50 0.54
51 0.52
52 0.52
53 0.49
54 0.55