Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7CUA8

Protein Details
Accession A0A5N7CUA8    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MMKPARARNACMRCRRQKLKVCYPPGHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MMKPARARNACMRCRRQKLKVCYPPGHSRGLILTACECDNIRPCQLCSRAGVDCQSVVSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.84
3 0.84
4 0.84
5 0.85
6 0.86
7 0.85
8 0.83
9 0.78
10 0.76
11 0.75
12 0.67
13 0.61
14 0.5
15 0.41
16 0.33
17 0.3
18 0.24
19 0.15
20 0.13
21 0.1
22 0.11
23 0.11
24 0.1
25 0.09
26 0.14
27 0.16
28 0.19
29 0.2
30 0.22
31 0.29
32 0.32
33 0.31
34 0.3
35 0.31
36 0.3
37 0.3
38 0.31
39 0.25
40 0.23
41 0.23