Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7CTA4

Protein Details
Accession A0A5N7CTA4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
23-49VSLPTNKVKGKRGKQHVRNNRRICPACHydrophilic
NLS Segment(s)
PositionSequence
33-35KRG
Subcellular Location(s) extr 12, mito 7, cyto 2, plas 2, golg 2
Family & Domain DBs
Amino Acid Sequences MLTIIGTRIILLVAAVTSFVLRVSLPTNKVKGKRGKQHVRNNRRICPACGVWEDIYQAGQVIRIKKLYHFLRCLRWEMCGYGLYCRVCSRCENCLQWATAKNDTEPAISEQLREDNCCPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.06
10 0.09
11 0.14
12 0.19
13 0.23
14 0.29
15 0.35
16 0.4
17 0.47
18 0.54
19 0.58
20 0.64
21 0.71
22 0.76
23 0.8
24 0.86
25 0.89
26 0.9
27 0.91
28 0.88
29 0.84
30 0.82
31 0.75
32 0.67
33 0.61
34 0.52
35 0.45
36 0.39
37 0.35
38 0.26
39 0.24
40 0.22
41 0.16
42 0.15
43 0.1
44 0.09
45 0.06
46 0.07
47 0.09
48 0.1
49 0.11
50 0.12
51 0.13
52 0.14
53 0.22
54 0.26
55 0.29
56 0.33
57 0.36
58 0.42
59 0.44
60 0.47
61 0.39
62 0.37
63 0.32
64 0.27
65 0.25
66 0.2
67 0.18
68 0.16
69 0.21
70 0.19
71 0.19
72 0.2
73 0.2
74 0.19
75 0.25
76 0.26
77 0.28
78 0.34
79 0.36
80 0.39
81 0.41
82 0.4
83 0.39
84 0.41
85 0.4
86 0.4
87 0.38
88 0.34
89 0.34
90 0.34
91 0.3
92 0.26
93 0.25
94 0.25
95 0.24
96 0.24
97 0.23
98 0.28
99 0.29
100 0.3