Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7D0M1

Protein Details
Accession A0A5N7D0M1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
4-25NTKGNRFKPRFHQTKWVQKRPEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MKQNTKGNRFKPRFHQTKWVQKRPESMLLVGIPSRWDPPTPSLPQLPRQLRSMERALEVLWVLGLGSFLHRGGYPNAREVVPWPSRILGECYPCEQGKRQRKIGGKAGQLVMHLLAKVHGVPGILRKIDMGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.75
4 0.8
5 0.84
6 0.83
7 0.79
8 0.74
9 0.77
10 0.72
11 0.71
12 0.62
13 0.52
14 0.45
15 0.39
16 0.36
17 0.28
18 0.22
19 0.15
20 0.13
21 0.14
22 0.12
23 0.12
24 0.13
25 0.18
26 0.25
27 0.27
28 0.29
29 0.33
30 0.35
31 0.41
32 0.47
33 0.47
34 0.42
35 0.41
36 0.42
37 0.38
38 0.39
39 0.36
40 0.28
41 0.24
42 0.22
43 0.2
44 0.17
45 0.15
46 0.1
47 0.07
48 0.05
49 0.04
50 0.03
51 0.03
52 0.02
53 0.03
54 0.03
55 0.04
56 0.04
57 0.05
58 0.06
59 0.09
60 0.14
61 0.15
62 0.17
63 0.18
64 0.18
65 0.18
66 0.18
67 0.23
68 0.2
69 0.2
70 0.19
71 0.18
72 0.19
73 0.2
74 0.23
75 0.19
76 0.21
77 0.21
78 0.23
79 0.26
80 0.26
81 0.27
82 0.29
83 0.36
84 0.42
85 0.49
86 0.53
87 0.57
88 0.64
89 0.69
90 0.72
91 0.69
92 0.63
93 0.61
94 0.57
95 0.5
96 0.43
97 0.37
98 0.28
99 0.21
100 0.17
101 0.12
102 0.1
103 0.09
104 0.09
105 0.09
106 0.09
107 0.08
108 0.09
109 0.15
110 0.21
111 0.21
112 0.21