Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DLU2

Protein Details
Accession A0A5N7DLU2    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
323-342ASDASDTKRKSWFKRRFSKDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MASPQQPAPPRHSRGFSFGGRSDKSSNSGSNKIRLTESAEEKHKRTLHTKADPMVAMSEAQPTDPDLSNPTRPRLERPLDTIRSFEAAIYGSYNSRPVSYARTDHESTPGAEYSRRSSYYGGHNGHHRGYNDQNGYYNGRGTYSRPESYMESNYGGGPPPENHYPYNQGGGRRPRRHRMEPEYHGAQNGYGSNGYHKSYENVTAASGSGSNTDPWANNSTDPSSVNSSIDQLQLQQQQQQQQLLQQQQQERAVAERYGFAGFGPEPNLSNGGALASGAAGTGPIKLGNSAPVADPTAGGPVGGPASAAGAPTTRRHLRKATNASDASDTKRKSWFKRRFSKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.55
4 0.52
5 0.5
6 0.51
7 0.48
8 0.49
9 0.46
10 0.42
11 0.41
12 0.39
13 0.41
14 0.39
15 0.46
16 0.46
17 0.49
18 0.5
19 0.48
20 0.46
21 0.4
22 0.41
23 0.4
24 0.43
25 0.43
26 0.49
27 0.52
28 0.52
29 0.59
30 0.56
31 0.53
32 0.51
33 0.54
34 0.55
35 0.59
36 0.63
37 0.59
38 0.59
39 0.54
40 0.49
41 0.41
42 0.31
43 0.23
44 0.17
45 0.17
46 0.13
47 0.13
48 0.12
49 0.12
50 0.15
51 0.15
52 0.15
53 0.16
54 0.21
55 0.29
56 0.32
57 0.35
58 0.38
59 0.39
60 0.45
61 0.5
62 0.52
63 0.48
64 0.52
65 0.57
66 0.56
67 0.55
68 0.5
69 0.42
70 0.37
71 0.33
72 0.25
73 0.17
74 0.12
75 0.11
76 0.11
77 0.1
78 0.09
79 0.1
80 0.12
81 0.11
82 0.11
83 0.12
84 0.12
85 0.17
86 0.2
87 0.23
88 0.25
89 0.31
90 0.32
91 0.32
92 0.34
93 0.3
94 0.27
95 0.26
96 0.23
97 0.18
98 0.18
99 0.19
100 0.19
101 0.22
102 0.23
103 0.21
104 0.21
105 0.24
106 0.31
107 0.38
108 0.36
109 0.34
110 0.37
111 0.38
112 0.39
113 0.39
114 0.31
115 0.27
116 0.28
117 0.33
118 0.31
119 0.29
120 0.28
121 0.27
122 0.29
123 0.25
124 0.23
125 0.15
126 0.15
127 0.15
128 0.15
129 0.2
130 0.22
131 0.23
132 0.22
133 0.24
134 0.25
135 0.28
136 0.28
137 0.22
138 0.18
139 0.18
140 0.17
141 0.16
142 0.14
143 0.1
144 0.09
145 0.08
146 0.11
147 0.13
148 0.15
149 0.15
150 0.17
151 0.22
152 0.21
153 0.26
154 0.24
155 0.24
156 0.27
157 0.37
158 0.45
159 0.49
160 0.54
161 0.58
162 0.64
163 0.7
164 0.72
165 0.72
166 0.71
167 0.67
168 0.68
169 0.62
170 0.55
171 0.47
172 0.38
173 0.29
174 0.21
175 0.16
176 0.11
177 0.07
178 0.07
179 0.09
180 0.11
181 0.12
182 0.12
183 0.12
184 0.13
185 0.14
186 0.18
187 0.16
188 0.14
189 0.14
190 0.13
191 0.12
192 0.11
193 0.1
194 0.06
195 0.07
196 0.07
197 0.07
198 0.08
199 0.09
200 0.09
201 0.11
202 0.14
203 0.14
204 0.14
205 0.16
206 0.17
207 0.17
208 0.17
209 0.17
210 0.18
211 0.18
212 0.18
213 0.16
214 0.17
215 0.17
216 0.17
217 0.15
218 0.11
219 0.16
220 0.2
221 0.21
222 0.25
223 0.26
224 0.31
225 0.34
226 0.36
227 0.31
228 0.3
229 0.35
230 0.35
231 0.36
232 0.35
233 0.36
234 0.38
235 0.4
236 0.37
237 0.31
238 0.28
239 0.26
240 0.22
241 0.19
242 0.15
243 0.14
244 0.13
245 0.13
246 0.1
247 0.11
248 0.1
249 0.11
250 0.12
251 0.11
252 0.12
253 0.13
254 0.15
255 0.12
256 0.12
257 0.1
258 0.08
259 0.08
260 0.06
261 0.05
262 0.04
263 0.03
264 0.03
265 0.03
266 0.03
267 0.03
268 0.04
269 0.04
270 0.05
271 0.05
272 0.06
273 0.07
274 0.1
275 0.11
276 0.12
277 0.13
278 0.14
279 0.16
280 0.15
281 0.15
282 0.12
283 0.13
284 0.12
285 0.11
286 0.09
287 0.08
288 0.09
289 0.08
290 0.07
291 0.05
292 0.07
293 0.07
294 0.08
295 0.07
296 0.09
297 0.11
298 0.14
299 0.23
300 0.29
301 0.33
302 0.38
303 0.47
304 0.54
305 0.62
306 0.7
307 0.68
308 0.7
309 0.68
310 0.65
311 0.62
312 0.55
313 0.52
314 0.5
315 0.45
316 0.39
317 0.47
318 0.52
319 0.57
320 0.65
321 0.68
322 0.71