Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MAH8

Protein Details
Accession C5MAH8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
219-246LKGKLLVSKKYNTKPRPKKENLSFSPSPHydrophilic
NLS Segment(s)
PositionSequence
227-236KKYNTKPRPK
Subcellular Location(s) nucl 15, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ctp:CTRG_03070  -  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
Amino Acid Sequences MPKVFTIQKNVLSHKKSIYKNLCASLIRHEHIITTSAKAKAAQPYIEKFLADSVRQSKELPESITDLKKKVESIKAFDYLQPAERMECGSKVLEEIVERYPKRQTGFTRIIKLEPRLGEDKAPMSVIELVDSNYEIKFWYTAKTVARLELQGIELDDLTELNIKKVTQFRRDGEATFRDAVEVCKKEFFNQDGETKDMPVDVQENLANLPNMERHTGKLKGKLLVSKKYNTKPRPKKENLSFSPSPFLKQNQQQEQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.6
3 0.57
4 0.62
5 0.63
6 0.63
7 0.65
8 0.65
9 0.62
10 0.55
11 0.52
12 0.5
13 0.49
14 0.41
15 0.37
16 0.33
17 0.29
18 0.28
19 0.3
20 0.22
21 0.19
22 0.23
23 0.22
24 0.23
25 0.24
26 0.26
27 0.3
28 0.33
29 0.33
30 0.33
31 0.36
32 0.4
33 0.4
34 0.36
35 0.28
36 0.29
37 0.28
38 0.24
39 0.25
40 0.25
41 0.27
42 0.29
43 0.29
44 0.27
45 0.29
46 0.31
47 0.28
48 0.23
49 0.25
50 0.28
51 0.34
52 0.34
53 0.3
54 0.29
55 0.29
56 0.3
57 0.31
58 0.35
59 0.32
60 0.35
61 0.38
62 0.4
63 0.39
64 0.38
65 0.35
66 0.28
67 0.27
68 0.23
69 0.19
70 0.16
71 0.16
72 0.16
73 0.14
74 0.13
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.08
82 0.1
83 0.12
84 0.18
85 0.18
86 0.2
87 0.23
88 0.25
89 0.26
90 0.3
91 0.3
92 0.32
93 0.41
94 0.44
95 0.47
96 0.45
97 0.46
98 0.44
99 0.42
100 0.38
101 0.29
102 0.28
103 0.24
104 0.24
105 0.22
106 0.2
107 0.19
108 0.15
109 0.14
110 0.1
111 0.09
112 0.09
113 0.08
114 0.08
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.08
127 0.09
128 0.12
129 0.13
130 0.18
131 0.18
132 0.19
133 0.19
134 0.18
135 0.17
136 0.15
137 0.14
138 0.1
139 0.1
140 0.08
141 0.07
142 0.07
143 0.06
144 0.04
145 0.04
146 0.07
147 0.07
148 0.08
149 0.09
150 0.09
151 0.12
152 0.2
153 0.25
154 0.29
155 0.35
156 0.37
157 0.42
158 0.44
159 0.42
160 0.41
161 0.38
162 0.34
163 0.29
164 0.27
165 0.21
166 0.19
167 0.21
168 0.23
169 0.22
170 0.2
171 0.23
172 0.23
173 0.26
174 0.31
175 0.3
176 0.28
177 0.29
178 0.32
179 0.3
180 0.34
181 0.32
182 0.27
183 0.25
184 0.2
185 0.16
186 0.13
187 0.13
188 0.09
189 0.1
190 0.1
191 0.1
192 0.11
193 0.13
194 0.12
195 0.1
196 0.11
197 0.13
198 0.14
199 0.17
200 0.17
201 0.18
202 0.24
203 0.32
204 0.35
205 0.4
206 0.43
207 0.44
208 0.48
209 0.53
210 0.54
211 0.56
212 0.57
213 0.57
214 0.62
215 0.66
216 0.73
217 0.74
218 0.79
219 0.8
220 0.86
221 0.89
222 0.88
223 0.9
224 0.9
225 0.91
226 0.86
227 0.84
228 0.78
229 0.7
230 0.7
231 0.59
232 0.52
233 0.46
234 0.45
235 0.45
236 0.5
237 0.57