Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M8G6

Protein Details
Accession C5M8G6    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
148-172KPQPKVISKRLLDRQKRRELWLRNEHydrophilic
NLS Segment(s)
PositionSequence
148-157KPQPKVISKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
KEGG ctp:CTRG_02688  -  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MFRTTIRRVSTKSIPYEPIPKNKYNQNRSVFNFKPVPTEGLVYNPPAAIVKPYMQTPYVFLPPNDPRREFAKQNCIDPSIVKEMPVIREFKAAHQREYNVTAETITKIKQLIKEDPERWTSKAISKEFNIELVKLHYFLRGELEKKLKPQPKVISKRLLDRQKRRELWLRNEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.59
4 0.58
5 0.6
6 0.58
7 0.56
8 0.56
9 0.62
10 0.68
11 0.67
12 0.7
13 0.67
14 0.68
15 0.69
16 0.73
17 0.65
18 0.61
19 0.59
20 0.5
21 0.48
22 0.41
23 0.39
24 0.3
25 0.31
26 0.24
27 0.22
28 0.23
29 0.19
30 0.18
31 0.15
32 0.14
33 0.12
34 0.12
35 0.1
36 0.1
37 0.11
38 0.12
39 0.13
40 0.15
41 0.15
42 0.15
43 0.16
44 0.18
45 0.2
46 0.19
47 0.18
48 0.24
49 0.3
50 0.38
51 0.4
52 0.38
53 0.36
54 0.41
55 0.46
56 0.45
57 0.43
58 0.45
59 0.43
60 0.45
61 0.44
62 0.4
63 0.35
64 0.3
65 0.27
66 0.22
67 0.2
68 0.17
69 0.17
70 0.16
71 0.18
72 0.2
73 0.19
74 0.13
75 0.17
76 0.18
77 0.21
78 0.3
79 0.29
80 0.3
81 0.3
82 0.31
83 0.3
84 0.33
85 0.29
86 0.19
87 0.18
88 0.16
89 0.14
90 0.14
91 0.13
92 0.1
93 0.1
94 0.11
95 0.13
96 0.17
97 0.21
98 0.26
99 0.3
100 0.38
101 0.39
102 0.41
103 0.44
104 0.43
105 0.4
106 0.37
107 0.33
108 0.31
109 0.37
110 0.36
111 0.35
112 0.33
113 0.37
114 0.34
115 0.37
116 0.32
117 0.24
118 0.23
119 0.21
120 0.21
121 0.17
122 0.17
123 0.15
124 0.15
125 0.15
126 0.2
127 0.21
128 0.22
129 0.27
130 0.34
131 0.34
132 0.39
133 0.49
134 0.49
135 0.49
136 0.57
137 0.6
138 0.64
139 0.72
140 0.74
141 0.74
142 0.71
143 0.76
144 0.77
145 0.78
146 0.77
147 0.78
148 0.81
149 0.82
150 0.83
151 0.82
152 0.81
153 0.8