Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M431

Protein Details
Accession C5M431   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
17-39TISEKVFRGKRAKRTAKRKGTLVHydrophilic
NLS Segment(s)
PositionSequence
24-35RGKRAKRTAKRK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037009  mRNA_triPase_Cet1_sf  
Gene Ontology GO:0004651  F:polynucleotide 5'-phosphatase activity  
KEGG ctp:CTRG_00820  -  
Amino Acid Sequences MIFLSIIHMVPFDFRITISEKVFRGKRAKRTAKRKGTLVLTREKETNVWCDSPNGTEFKSSTVIDSSVDEPNRYEFEIELDIESVVDDIRDREDPYYYDIEEFINNLILEADSINDEIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.15
4 0.19
5 0.21
6 0.24
7 0.24
8 0.32
9 0.34
10 0.39
11 0.45
12 0.49
13 0.56
14 0.62
15 0.72
16 0.75
17 0.83
18 0.87
19 0.88
20 0.85
21 0.79
22 0.74
23 0.71
24 0.68
25 0.61
26 0.59
27 0.52
28 0.49
29 0.45
30 0.4
31 0.33
32 0.28
33 0.29
34 0.22
35 0.2
36 0.18
37 0.19
38 0.19
39 0.19
40 0.19
41 0.16
42 0.13
43 0.13
44 0.13
45 0.13
46 0.15
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.12
53 0.12
54 0.14
55 0.14
56 0.14
57 0.13
58 0.15
59 0.15
60 0.14
61 0.12
62 0.08
63 0.1
64 0.12
65 0.12
66 0.1
67 0.09
68 0.09
69 0.08
70 0.08
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.07
77 0.09
78 0.1
79 0.11
80 0.13
81 0.14
82 0.18
83 0.2
84 0.19
85 0.18
86 0.17
87 0.17
88 0.16
89 0.15
90 0.12
91 0.12
92 0.11
93 0.11
94 0.11
95 0.09
96 0.09
97 0.09
98 0.09
99 0.07