Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DMN2

Protein Details
Accession A0A5N7DMN2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MKGKMEESCWRNRKRKRKRVRGCKDNKQKSEYNBasic
NLS Segment(s)
PositionSequence
12-22NRKRKRKRVRG
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKGKMEESCWRNRKRKRKRVRGCKDNKQKSEYNKMFLGRYTPSMSCLVGTTTMYFLVLTNRRVSEEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.89
3 0.89
4 0.91
5 0.93
6 0.95
7 0.96
8 0.96
9 0.94
10 0.94
11 0.94
12 0.93
13 0.87
14 0.82
15 0.76
16 0.71
17 0.72
18 0.64
19 0.56
20 0.48
21 0.44
22 0.39
23 0.34
24 0.3
25 0.2
26 0.2
27 0.2
28 0.17
29 0.18
30 0.19
31 0.19
32 0.16
33 0.15
34 0.13
35 0.11
36 0.12
37 0.1
38 0.09
39 0.09
40 0.09
41 0.09
42 0.08
43 0.15
44 0.19
45 0.2
46 0.24
47 0.25