Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DJB1

Protein Details
Accession A0A5N7DJB1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
8-44MSRGEVKEIHKRERRNRKRERGDERLRGKRRRRLKIEBasic
NLS Segment(s)
PositionSequence
13-42VKEIHKRERRNRKRERGDERLRGKRRRRLK
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRWGWGRMSRGEVKEIHKRERRNRKRERGDERLRGKRRRRLKIEDVVVVIVRGARIFFGGTLTIPGVVTLLPSVYLLEYFPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.52
3 0.55
4 0.54
5 0.62
6 0.68
7 0.75
8 0.8
9 0.81
10 0.86
11 0.88
12 0.92
13 0.93
14 0.91
15 0.91
16 0.89
17 0.88
18 0.86
19 0.85
20 0.83
21 0.82
22 0.82
23 0.79
24 0.8
25 0.8
26 0.79
27 0.77
28 0.77
29 0.76
30 0.71
31 0.65
32 0.55
33 0.46
34 0.38
35 0.28
36 0.2
37 0.12
38 0.08
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.06
54 0.05
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.06