Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CW43

Protein Details
Accession A0A5N7CW43   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MVKLRSIRKRASNSPRSRRQQRAHRKDNLFFHydrophilic
NLS Segment(s)
PositionSequence
7-25IRKRASNSPRSRRQQRAHR
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
Amino Acid Sequences MVKLRSIRKRASNSPRSRRQQRAHRKDNLFFKCFEYCQECDADIFIMIRLRHNGQIQFFNSNDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.88
5 0.88
6 0.87
7 0.87
8 0.88
9 0.88
10 0.87
11 0.87
12 0.83
13 0.8
14 0.8
15 0.75
16 0.66
17 0.56
18 0.5
19 0.42
20 0.36
21 0.32
22 0.27
23 0.21
24 0.21
25 0.21
26 0.18
27 0.16
28 0.16
29 0.14
30 0.09
31 0.09
32 0.08
33 0.11
34 0.11
35 0.13
36 0.16
37 0.18
38 0.22
39 0.27
40 0.3
41 0.3
42 0.37
43 0.38
44 0.39