Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6HRG8

Protein Details
Accession A0A5N6HRG8    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
205-231GSAGRGHQLRERERRRRWSGAEREDYGBasic
NLS Segment(s)
PositionSequence
189-198RTRGKGKASP
207-221AGRGHQLRERERRRR
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
Amino Acid Sequences MFNRNLPGPGSRDPIVIDDESEDEDMNVDYSGRQNHPRGIDPRYDSDRLRGPLTTYHTTIEQEKKVRSRLREERHAALCVLMDRELLTMQALAAQETLPQARRRFLSKLIAPEDPEVAASIRNDLFIVQNHYSPSPSNPPLVVHRNVVDVHETDDAGWRRPADAGGSSSAFSSPASSSKNKGRLSTPDRTRGKGKASPASSSVSGSAGRGHQLRERERRRRWSGAEREDYGISSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.25
4 0.2
5 0.16
6 0.16
7 0.17
8 0.17
9 0.14
10 0.1
11 0.11
12 0.1
13 0.09
14 0.08
15 0.06
16 0.07
17 0.1
18 0.15
19 0.19
20 0.25
21 0.28
22 0.33
23 0.36
24 0.43
25 0.44
26 0.44
27 0.47
28 0.45
29 0.49
30 0.5
31 0.5
32 0.43
33 0.44
34 0.47
35 0.42
36 0.39
37 0.33
38 0.28
39 0.3
40 0.36
41 0.35
42 0.29
43 0.28
44 0.28
45 0.29
46 0.33
47 0.33
48 0.32
49 0.33
50 0.37
51 0.41
52 0.47
53 0.52
54 0.5
55 0.54
56 0.59
57 0.62
58 0.67
59 0.67
60 0.66
61 0.63
62 0.6
63 0.49
64 0.39
65 0.32
66 0.22
67 0.18
68 0.12
69 0.09
70 0.07
71 0.08
72 0.07
73 0.07
74 0.06
75 0.05
76 0.04
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.09
85 0.1
86 0.14
87 0.16
88 0.18
89 0.2
90 0.23
91 0.25
92 0.28
93 0.32
94 0.3
95 0.35
96 0.35
97 0.35
98 0.32
99 0.3
100 0.27
101 0.19
102 0.16
103 0.11
104 0.08
105 0.07
106 0.06
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.13
115 0.12
116 0.14
117 0.15
118 0.15
119 0.15
120 0.15
121 0.17
122 0.18
123 0.18
124 0.18
125 0.18
126 0.19
127 0.24
128 0.29
129 0.28
130 0.23
131 0.22
132 0.23
133 0.23
134 0.22
135 0.19
136 0.14
137 0.14
138 0.13
139 0.12
140 0.1
141 0.17
142 0.17
143 0.17
144 0.18
145 0.16
146 0.16
147 0.16
148 0.16
149 0.12
150 0.13
151 0.13
152 0.14
153 0.14
154 0.14
155 0.14
156 0.13
157 0.12
158 0.09
159 0.1
160 0.08
161 0.11
162 0.15
163 0.17
164 0.22
165 0.29
166 0.38
167 0.39
168 0.41
169 0.42
170 0.48
171 0.53
172 0.59
173 0.58
174 0.59
175 0.61
176 0.62
177 0.63
178 0.58
179 0.58
180 0.53
181 0.52
182 0.51
183 0.5
184 0.49
185 0.46
186 0.45
187 0.39
188 0.35
189 0.29
190 0.22
191 0.19
192 0.17
193 0.17
194 0.14
195 0.17
196 0.18
197 0.2
198 0.23
199 0.31
200 0.4
201 0.48
202 0.58
203 0.64
204 0.72
205 0.8
206 0.84
207 0.85
208 0.84
209 0.84
210 0.84
211 0.84
212 0.82
213 0.75
214 0.7
215 0.61