Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5MGQ0

Protein Details
Accession C5MGQ0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
55-78GNTYQPSTRKRKRKFGFLARLRTVHydrophilic
NLS Segment(s)
PositionSequence
63-92RKRKRKFGFLARLRTVGGRKVIERRKAKGR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ctp:CTRG_05254  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFSSILRQSTRGLINTSIASTRPTAFSSPLANSLISVSPLQSVVGLMQQRFKSRGNTYQPSTRKRKRKFGFLARLRTVGGRKVIERRKAKGRWYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.26
4 0.21
5 0.17
6 0.17
7 0.15
8 0.15
9 0.14
10 0.15
11 0.16
12 0.16
13 0.18
14 0.19
15 0.19
16 0.2
17 0.2
18 0.18
19 0.16
20 0.16
21 0.14
22 0.12
23 0.11
24 0.08
25 0.08
26 0.08
27 0.08
28 0.06
29 0.06
30 0.05
31 0.08
32 0.09
33 0.08
34 0.13
35 0.14
36 0.16
37 0.18
38 0.2
39 0.22
40 0.25
41 0.33
42 0.36
43 0.41
44 0.43
45 0.49
46 0.55
47 0.58
48 0.64
49 0.65
50 0.68
51 0.7
52 0.78
53 0.75
54 0.79
55 0.8
56 0.81
57 0.83
58 0.81
59 0.83
60 0.74
61 0.7
62 0.6
63 0.54
64 0.45
65 0.39
66 0.36
67 0.3
68 0.31
69 0.39
70 0.47
71 0.53
72 0.57
73 0.59
74 0.64
75 0.68
76 0.72
77 0.72