Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N6I795

Protein Details
Accession A0A5N6I795    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
53-78GKAGQCRVDRRRKKGNLRRKCDTDKPBasic
NLS Segment(s)
PositionSequence
62-71RRRKKGNLRR
Subcellular Location(s) nucl 12, mito 6, cyto 5, extr 2
Family & Domain DBs
Amino Acid Sequences MHSVILLTLLFLGFSVAVQPTYPNRKLPPLRGDPQNGVDPMHMIETGYCKMGGKAGQCRVDRRRKKGNLRRKCDTDKPCTKDEDPCSIRWGPGDDQKPSVINVNCHLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.06
4 0.06
5 0.06
6 0.09
7 0.15
8 0.23
9 0.26
10 0.29
11 0.31
12 0.41
13 0.46
14 0.51
15 0.54
16 0.54
17 0.57
18 0.59
19 0.61
20 0.55
21 0.53
22 0.49
23 0.4
24 0.33
25 0.26
26 0.21
27 0.17
28 0.14
29 0.11
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.08
36 0.08
37 0.08
38 0.1
39 0.11
40 0.12
41 0.17
42 0.22
43 0.29
44 0.3
45 0.36
46 0.43
47 0.52
48 0.57
49 0.59
50 0.65
51 0.67
52 0.77
53 0.81
54 0.84
55 0.83
56 0.84
57 0.85
58 0.82
59 0.8
60 0.79
61 0.76
62 0.76
63 0.75
64 0.72
65 0.67
66 0.65
67 0.59
68 0.58
69 0.55
70 0.55
71 0.48
72 0.44
73 0.46
74 0.41
75 0.4
76 0.33
77 0.33
78 0.26
79 0.32
80 0.36
81 0.34
82 0.35
83 0.37
84 0.36
85 0.33
86 0.37
87 0.32
88 0.29