Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5MCY5

Protein Details
Accession C5MCY5   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
111-135ASKMHAKKVERMRKREKRNKLLKERBasic
NLS Segment(s)
PositionSequence
29-135SRVNGKNWKIKKDAFRVRTIGVVSKTKKNSFKQRELKKLEEEQYKARMKELKDEKETARKQKLDDLKRRREIKEEKERYERMASKMHAKKVERMRKREKRNKLLKER
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
KEGG ctp:CTRG_04086  -  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSSSSNIEFKEIPKKYIDPLAPKDKGEGSRVNGKNWKIKKDAFRVRTIGVVSKTKKNSFKQRELKKLEEEQYKARMKELKDEKETARKQKLDDLKRRREIKEEKERYERMASKMHAKKVERMRKREKRNKLLKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.41
4 0.43
5 0.41
6 0.47
7 0.54
8 0.52
9 0.51
10 0.5
11 0.47
12 0.45
13 0.41
14 0.38
15 0.33
16 0.41
17 0.42
18 0.45
19 0.46
20 0.47
21 0.51
22 0.52
23 0.53
24 0.48
25 0.53
26 0.56
27 0.6
28 0.66
29 0.62
30 0.62
31 0.58
32 0.54
33 0.5
34 0.42
35 0.36
36 0.29
37 0.32
38 0.29
39 0.34
40 0.37
41 0.4
42 0.47
43 0.5
44 0.57
45 0.59
46 0.67
47 0.7
48 0.74
49 0.78
50 0.77
51 0.74
52 0.68
53 0.65
54 0.61
55 0.56
56 0.49
57 0.42
58 0.44
59 0.44
60 0.39
61 0.36
62 0.34
63 0.29
64 0.36
65 0.42
66 0.41
67 0.41
68 0.44
69 0.45
70 0.51
71 0.56
72 0.55
73 0.55
74 0.49
75 0.47
76 0.52
77 0.58
78 0.58
79 0.63
80 0.65
81 0.67
82 0.74
83 0.79
84 0.73
85 0.73
86 0.72
87 0.72
88 0.73
89 0.72
90 0.7
91 0.72
92 0.71
93 0.66
94 0.66
95 0.6
96 0.52
97 0.51
98 0.46
99 0.48
100 0.54
101 0.56
102 0.55
103 0.53
104 0.59
105 0.62
106 0.71
107 0.7
108 0.73
109 0.77
110 0.8
111 0.89
112 0.9
113 0.91
114 0.91
115 0.92