Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M9S5

Protein Details
Accession C5M9S5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-69FKEDRKRKIAERPKKDFTRSHBasic
NLS Segment(s)
PositionSequence
53-70RKRKIAERPKKDFTRSHR
Subcellular Location(s) mito 21, nucl 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0006412  P:translation  
KEGG ctp:CTRG_02237  -  
Amino Acid Sequences MAKGRANTTMIKLVSTALTGYEKWFRIPRSSPKLNLILYDPRAQRHCLFKEDRKRKIAERPKKDFTRSHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.14
4 0.08
5 0.1
6 0.1
7 0.12
8 0.16
9 0.16
10 0.18
11 0.22
12 0.23
13 0.27
14 0.32
15 0.4
16 0.44
17 0.48
18 0.48
19 0.48
20 0.51
21 0.45
22 0.4
23 0.33
24 0.29
25 0.27
26 0.3
27 0.27
28 0.25
29 0.27
30 0.29
31 0.3
32 0.33
33 0.34
34 0.35
35 0.41
36 0.48
37 0.57
38 0.64
39 0.69
40 0.67
41 0.68
42 0.67
43 0.71
44 0.73
45 0.73
46 0.74
47 0.74
48 0.78
49 0.82
50 0.82