Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C5M4N6

Protein Details
Accession C5M4N6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
161-180VDSSKIKRNVLKYRNKIDDYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito 5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR022801  Ribosomal_S4/S9  
IPR001912  Ribosomal_S4/S9_N  
IPR002942  S4_RNA-bd  
IPR036986  S4_RNA-bd_sf  
Gene Ontology GO:0034457  C:Mpp10 complex  
GO:0015935  C:small ribosomal subunit  
GO:0032040  C:small-subunit processome  
GO:0019843  F:rRNA binding  
GO:0030515  F:snoRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0042274  P:ribosomal small subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG ctp:CTRG_01026  -  
Pfam View protein in Pfam  
PF00163  Ribosomal_S4  
PF01479  S4  
PROSITE View protein in PROSITE  
PS50889  S4  
CDD cd00165  S4  
Amino Acid Sequences MVRVLKHHEKKLLKKVDFLNWKQDQGHRDTQVMRTYHLQNREDYHKYNRMCGDIRKLAHKLSLLQATDPYRIKHEQLLLDKLYDMGILATKSKISDLENKVTVSSFCRRRIGVVMCRLKMSETISDAVKFIEQGHVRVGPNVITDPAYLVTRNMEDYLTWVDSSKIKRNVLKYRNKIDDYELS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.7
3 0.7
4 0.71
5 0.65
6 0.65
7 0.58
8 0.59
9 0.56
10 0.55
11 0.49
12 0.47
13 0.52
14 0.44
15 0.44
16 0.43
17 0.44
18 0.46
19 0.42
20 0.37
21 0.34
22 0.39
23 0.4
24 0.45
25 0.42
26 0.39
27 0.43
28 0.47
29 0.46
30 0.44
31 0.46
32 0.46
33 0.45
34 0.48
35 0.45
36 0.43
37 0.42
38 0.42
39 0.42
40 0.41
41 0.41
42 0.41
43 0.41
44 0.37
45 0.36
46 0.33
47 0.27
48 0.25
49 0.29
50 0.23
51 0.22
52 0.25
53 0.24
54 0.27
55 0.27
56 0.23
57 0.22
58 0.23
59 0.24
60 0.23
61 0.25
62 0.25
63 0.27
64 0.3
65 0.27
66 0.25
67 0.24
68 0.21
69 0.17
70 0.12
71 0.08
72 0.04
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.08
82 0.17
83 0.2
84 0.24
85 0.25
86 0.25
87 0.25
88 0.24
89 0.23
90 0.18
91 0.22
92 0.24
93 0.26
94 0.28
95 0.28
96 0.3
97 0.35
98 0.38
99 0.38
100 0.41
101 0.44
102 0.42
103 0.43
104 0.41
105 0.35
106 0.31
107 0.26
108 0.19
109 0.15
110 0.16
111 0.16
112 0.17
113 0.16
114 0.15
115 0.12
116 0.1
117 0.09
118 0.14
119 0.14
120 0.15
121 0.17
122 0.21
123 0.21
124 0.22
125 0.22
126 0.15
127 0.16
128 0.16
129 0.14
130 0.11
131 0.11
132 0.11
133 0.11
134 0.12
135 0.11
136 0.1
137 0.11
138 0.12
139 0.13
140 0.13
141 0.12
142 0.1
143 0.13
144 0.17
145 0.16
146 0.15
147 0.14
148 0.15
149 0.2
150 0.26
151 0.33
152 0.36
153 0.41
154 0.47
155 0.56
156 0.65
157 0.7
158 0.75
159 0.75
160 0.78
161 0.82
162 0.79
163 0.72