Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6IIY9

Protein Details
Accession A0A5N6IIY9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-34QIRPLIKHIRRIHQNRQRHDRRKPSSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8.5, plas 7, cyto_mito 6, E.R. 3, cyto 2.5, extr 2, pero 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLGLIQIRPLIKHIRRIHQNRQRHDRRKPSSSSHFVFLRLPNIPYSLWTAPGRIRRSLKGLRVDDYAGLLVGHSGCIFLLFFPASLFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.6
4 0.68
5 0.76
6 0.75
7 0.81
8 0.81
9 0.85
10 0.86
11 0.85
12 0.87
13 0.86
14 0.85
15 0.83
16 0.79
17 0.76
18 0.74
19 0.72
20 0.64
21 0.58
22 0.51
23 0.45
24 0.42
25 0.35
26 0.29
27 0.22
28 0.21
29 0.17
30 0.17
31 0.15
32 0.13
33 0.17
34 0.14
35 0.16
36 0.15
37 0.16
38 0.19
39 0.27
40 0.29
41 0.3
42 0.33
43 0.31
44 0.39
45 0.43
46 0.46
47 0.48
48 0.47
49 0.44
50 0.43
51 0.42
52 0.35
53 0.29
54 0.23
55 0.14
56 0.11
57 0.08
58 0.07
59 0.06
60 0.06
61 0.05
62 0.05
63 0.04
64 0.05
65 0.05
66 0.05
67 0.07
68 0.08
69 0.08
70 0.08