Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q755Q2

Protein Details
Accession Q755Q2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-117EQEIEAKKRVHRQLRQRVEEIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011425  Med9  
Gene Ontology GO:0070847  C:core mediator complex  
GO:0005829  C:cytosol  
GO:0016592  C:mediator complex  
GO:0005198  F:structural molecule activity  
GO:0003713  F:transcription coactivator activity  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0032968  P:positive regulation of transcription elongation by RNA polymerase II  
GO:0060261  P:positive regulation of transcription initiation by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
KEGG ago:AGOS_AFL182C  -  
Pfam View protein in Pfam  
PF07544  Med9  
Amino Acid Sequences MSAQASPATELQNPTLGQVYATLTRHSAQQTEFIPHIFYALHQLKNDNGHTNTFETATSNIRHRLKLCKAAIAGDAHAVEMLSRPCDEWPAVVCQKEQEIEAKKRVHRQLRQRVEEIAGPLDAAAAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.19
4 0.16
5 0.16
6 0.17
7 0.17
8 0.18
9 0.18
10 0.17
11 0.18
12 0.21
13 0.21
14 0.21
15 0.17
16 0.21
17 0.22
18 0.24
19 0.24
20 0.21
21 0.21
22 0.18
23 0.17
24 0.12
25 0.1
26 0.16
27 0.19
28 0.21
29 0.21
30 0.22
31 0.23
32 0.28
33 0.3
34 0.26
35 0.23
36 0.22
37 0.23
38 0.24
39 0.22
40 0.18
41 0.16
42 0.12
43 0.12
44 0.13
45 0.13
46 0.14
47 0.2
48 0.21
49 0.23
50 0.24
51 0.3
52 0.32
53 0.39
54 0.38
55 0.34
56 0.33
57 0.32
58 0.33
59 0.25
60 0.21
61 0.14
62 0.13
63 0.09
64 0.09
65 0.08
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.1
74 0.1
75 0.1
76 0.11
77 0.18
78 0.21
79 0.21
80 0.21
81 0.21
82 0.22
83 0.22
84 0.21
85 0.21
86 0.26
87 0.31
88 0.38
89 0.43
90 0.46
91 0.54
92 0.63
93 0.66
94 0.66
95 0.72
96 0.76
97 0.8
98 0.82
99 0.76
100 0.7
101 0.63
102 0.57
103 0.48
104 0.39
105 0.28
106 0.21
107 0.18