Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CY12

Protein Details
Accession A0A5N7CY12   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
334-362LASDPDQKKNLRRIRKKLSHCQNPEKAGVHydrophilic
388-407EMERLAKKRKLDGERPKDIFBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013763  Cyclin-like_dom  
IPR036915  Cyclin-like_sf  
IPR043198  Cyclin/Ssn8  
IPR031658  Cyclin_C_2  
IPR006671  Cyclin_N  
Gene Ontology GO:0005634  C:nucleus  
GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF16899  Cyclin_C_2  
PF00134  Cyclin_N  
CDD cd20524  CYCLIN_CCNH_rpt1  
cd20525  CYCLIN_CCNH_rpt2  
Amino Acid Sequences MIEDDFYRSSSQFRLWSYTETSLQSLRATTNANASERVRSALRKSRGAQRSATSSAAGTPAANQNGSDADSKAGGDDTEIECLTPEEEHQLVRYFCEQIIELGEMYKPPLPTIVRATAIQYLRRFYLTNSPMTYHPKSIMLCALFLATKTDNYYLSLRQFAEVIPGGTTPEDIVQPEFLVMQSLRFTFDVRHPFRGLEGGIMELQAISQGMGQPAPHFPTQTPDDLKRRLHSLPPSPTTPSSSTTDRLARAHHNTRETLKSAAQMTDAYFLYTPSQIWLAALMIADKPLAEFYLETKLGGPQQQQQGSPLYELRTKLLRTLTNCSNLLQAYKPLASDPDQKKNLRRIRKKLSHCQNPEKAGVAGQKRIPAAAAAAVAAAGDPATSESEMERLAKKRKLDGERPKDIFGGELVTQRTKEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.36
4 0.39
5 0.41
6 0.4
7 0.37
8 0.37
9 0.32
10 0.32
11 0.28
12 0.25
13 0.21
14 0.2
15 0.21
16 0.2
17 0.25
18 0.28
19 0.29
20 0.31
21 0.32
22 0.34
23 0.32
24 0.34
25 0.29
26 0.3
27 0.37
28 0.42
29 0.47
30 0.5
31 0.54
32 0.61
33 0.65
34 0.65
35 0.61
36 0.56
37 0.57
38 0.52
39 0.49
40 0.39
41 0.32
42 0.29
43 0.25
44 0.21
45 0.14
46 0.13
47 0.18
48 0.19
49 0.19
50 0.17
51 0.17
52 0.18
53 0.2
54 0.18
55 0.13
56 0.12
57 0.13
58 0.13
59 0.12
60 0.11
61 0.09
62 0.08
63 0.11
64 0.11
65 0.13
66 0.13
67 0.12
68 0.12
69 0.12
70 0.13
71 0.09
72 0.09
73 0.1
74 0.11
75 0.11
76 0.13
77 0.17
78 0.17
79 0.19
80 0.2
81 0.18
82 0.17
83 0.19
84 0.17
85 0.14
86 0.16
87 0.14
88 0.12
89 0.11
90 0.11
91 0.1
92 0.11
93 0.13
94 0.11
95 0.1
96 0.15
97 0.15
98 0.18
99 0.23
100 0.25
101 0.24
102 0.24
103 0.26
104 0.28
105 0.29
106 0.31
107 0.28
108 0.26
109 0.25
110 0.26
111 0.25
112 0.2
113 0.28
114 0.26
115 0.29
116 0.28
117 0.29
118 0.31
119 0.38
120 0.38
121 0.3
122 0.28
123 0.28
124 0.27
125 0.26
126 0.27
127 0.2
128 0.18
129 0.16
130 0.16
131 0.12
132 0.11
133 0.13
134 0.09
135 0.09
136 0.11
137 0.12
138 0.12
139 0.14
140 0.16
141 0.16
142 0.17
143 0.2
144 0.18
145 0.18
146 0.17
147 0.15
148 0.16
149 0.14
150 0.13
151 0.09
152 0.09
153 0.09
154 0.09
155 0.09
156 0.06
157 0.06
158 0.06
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.06
165 0.05
166 0.06
167 0.06
168 0.06
169 0.07
170 0.07
171 0.09
172 0.09
173 0.09
174 0.1
175 0.16
176 0.25
177 0.27
178 0.3
179 0.29
180 0.29
181 0.29
182 0.29
183 0.23
184 0.14
185 0.11
186 0.09
187 0.08
188 0.07
189 0.07
190 0.05
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.04
197 0.04
198 0.05
199 0.05
200 0.06
201 0.07
202 0.1
203 0.1
204 0.1
205 0.1
206 0.14
207 0.16
208 0.2
209 0.22
210 0.25
211 0.3
212 0.34
213 0.36
214 0.33
215 0.35
216 0.32
217 0.35
218 0.35
219 0.38
220 0.4
221 0.42
222 0.42
223 0.41
224 0.4
225 0.39
226 0.35
227 0.3
228 0.26
229 0.25
230 0.25
231 0.26
232 0.28
233 0.26
234 0.25
235 0.25
236 0.27
237 0.32
238 0.38
239 0.39
240 0.39
241 0.39
242 0.42
243 0.43
244 0.39
245 0.33
246 0.27
247 0.25
248 0.24
249 0.22
250 0.19
251 0.16
252 0.15
253 0.16
254 0.15
255 0.12
256 0.11
257 0.11
258 0.11
259 0.11
260 0.1
261 0.08
262 0.09
263 0.08
264 0.07
265 0.07
266 0.06
267 0.06
268 0.06
269 0.06
270 0.05
271 0.06
272 0.06
273 0.05
274 0.05
275 0.04
276 0.05
277 0.05
278 0.05
279 0.06
280 0.13
281 0.13
282 0.13
283 0.14
284 0.15
285 0.18
286 0.21
287 0.21
288 0.21
289 0.29
290 0.31
291 0.31
292 0.31
293 0.33
294 0.31
295 0.3
296 0.26
297 0.21
298 0.22
299 0.23
300 0.23
301 0.24
302 0.24
303 0.26
304 0.29
305 0.31
306 0.32
307 0.38
308 0.41
309 0.42
310 0.42
311 0.39
312 0.36
313 0.32
314 0.3
315 0.25
316 0.22
317 0.19
318 0.19
319 0.18
320 0.16
321 0.18
322 0.2
323 0.29
324 0.33
325 0.4
326 0.47
327 0.51
328 0.58
329 0.66
330 0.71
331 0.72
332 0.76
333 0.76
334 0.8
335 0.86
336 0.88
337 0.89
338 0.9
339 0.9
340 0.89
341 0.89
342 0.86
343 0.81
344 0.73
345 0.65
346 0.54
347 0.48
348 0.46
349 0.4
350 0.37
351 0.35
352 0.37
353 0.34
354 0.34
355 0.29
356 0.23
357 0.19
358 0.15
359 0.13
360 0.09
361 0.09
362 0.08
363 0.07
364 0.06
365 0.05
366 0.03
367 0.03
368 0.03
369 0.04
370 0.06
371 0.07
372 0.07
373 0.08
374 0.1
375 0.12
376 0.15
377 0.2
378 0.25
379 0.34
380 0.38
381 0.42
382 0.49
383 0.57
384 0.64
385 0.69
386 0.73
387 0.75
388 0.8
389 0.8
390 0.74
391 0.65
392 0.55
393 0.46
394 0.35
395 0.3
396 0.21
397 0.22
398 0.23
399 0.25