Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DH49

Protein Details
Accession A0A5N7DH49   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
65-93DYRFLSSWIKPKRPSRRKRNNSLEILQTPHydrophilic
NLS Segment(s)
PositionSequence
74-83KPKRPSRRKR
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRCSTGQQRQSYGGLSLHASRLILHTARFYQDISQFAAFATSKKSLRVLSHTSMITNTRCGCLVDYRFLSSWIKPKRPSRRKRNNSLEILQTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.17
5 0.16
6 0.14
7 0.12
8 0.13
9 0.15
10 0.14
11 0.13
12 0.15
13 0.15
14 0.17
15 0.18
16 0.17
17 0.17
18 0.19
19 0.19
20 0.2
21 0.18
22 0.16
23 0.15
24 0.17
25 0.13
26 0.11
27 0.12
28 0.13
29 0.14
30 0.14
31 0.17
32 0.17
33 0.18
34 0.23
35 0.25
36 0.24
37 0.27
38 0.26
39 0.24
40 0.23
41 0.25
42 0.2
43 0.18
44 0.17
45 0.14
46 0.14
47 0.15
48 0.15
49 0.19
50 0.2
51 0.22
52 0.23
53 0.25
54 0.25
55 0.27
56 0.27
57 0.24
58 0.31
59 0.34
60 0.4
61 0.45
62 0.55
63 0.64
64 0.73
65 0.81
66 0.84
67 0.86
68 0.9
69 0.93
70 0.94
71 0.93
72 0.9
73 0.85