Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5M8M8

Protein Details
Accession C5M8M8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-64NQNYNRYHHHHNNNNNNNKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
KEGG ctp:CTRG_02750  -  
Amino Acid Sequences MKYPKREINSEPFKNQLDIIERITIEIKHQSNNPIFKTNQRFTNNQNYNRYHHHHNNNNNNNKNKKYGGSNYQYNNYGNFQPALNVETTTTSTTTRLDFNNENLQYKLVDKLFDPFKPVELDYGSMNTNIWRSNNDTTNNNGSNGNCIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.46
3 0.4
4 0.35
5 0.31
6 0.3
7 0.27
8 0.25
9 0.25
10 0.26
11 0.22
12 0.19
13 0.24
14 0.22
15 0.22
16 0.25
17 0.31
18 0.36
19 0.42
20 0.42
21 0.4
22 0.4
23 0.45
24 0.52
25 0.49
26 0.52
27 0.5
28 0.5
29 0.5
30 0.6
31 0.6
32 0.58
33 0.62
34 0.56
35 0.56
36 0.59
37 0.59
38 0.56
39 0.57
40 0.59
41 0.59
42 0.66
43 0.72
44 0.76
45 0.8
46 0.78
47 0.77
48 0.73
49 0.67
50 0.62
51 0.53
52 0.45
53 0.42
54 0.4
55 0.41
56 0.4
57 0.44
58 0.41
59 0.42
60 0.42
61 0.36
62 0.33
63 0.26
64 0.21
65 0.16
66 0.15
67 0.12
68 0.1
69 0.11
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.09
79 0.1
80 0.11
81 0.12
82 0.13
83 0.12
84 0.16
85 0.17
86 0.21
87 0.29
88 0.29
89 0.3
90 0.28
91 0.28
92 0.24
93 0.23
94 0.24
95 0.16
96 0.15
97 0.13
98 0.19
99 0.22
100 0.22
101 0.25
102 0.21
103 0.22
104 0.24
105 0.24
106 0.21
107 0.18
108 0.19
109 0.16
110 0.18
111 0.16
112 0.14
113 0.14
114 0.13
115 0.13
116 0.14
117 0.14
118 0.15
119 0.2
120 0.27
121 0.33
122 0.36
123 0.37
124 0.41
125 0.49
126 0.48
127 0.43
128 0.4
129 0.34