Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DJI5

Protein Details
Accession A0A5N7DJI5   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MKKQRKHNSKTMKEEKKRKDRRRGKRPGKSKVKITDQBasic
NLS Segment(s)
PositionSequence
2-32KKQRKHNSKTMKEEKKRKDRRRGKRPGKSKV
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MKKQRKHNSKTMKEEKKRKDRRRGKRPGKSKVKITDQLAHVEVKSTPTARSQQPSRRTVSEAPWLTQMPMNRPLKMPQFHQMTRRRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.92
4 0.93
5 0.92
6 0.93
7 0.92
8 0.93
9 0.94
10 0.94
11 0.94
12 0.94
13 0.93
14 0.93
15 0.93
16 0.88
17 0.85
18 0.82
19 0.79
20 0.75
21 0.69
22 0.64
23 0.55
24 0.51
25 0.44
26 0.36
27 0.27
28 0.22
29 0.18
30 0.13
31 0.12
32 0.1
33 0.1
34 0.12
35 0.16
36 0.18
37 0.24
38 0.3
39 0.37
40 0.44
41 0.48
42 0.5
43 0.48
44 0.5
45 0.47
46 0.44
47 0.45
48 0.39
49 0.36
50 0.35
51 0.33
52 0.3
53 0.29
54 0.27
55 0.22
56 0.3
57 0.31
58 0.3
59 0.32
60 0.37
61 0.43
62 0.45
63 0.44
64 0.43
65 0.49
66 0.52
67 0.59
68 0.62