Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7DAI5

Protein Details
Accession A0A5N7DAI5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
83-110ASPEKTASPSKKRCVKRKNKSEPEDDGVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MKPANPRPKAKTDEHLVFLYLCLVNSGGANNIDFNAVAVASNINVPAARMRWARLKARIEKEMADGSSDPNAGEPSAASTPTASPEKTASPSKKRCVKRKNKSEPEDDGVAENNDESNPTAEAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.46
4 0.39
5 0.33
6 0.28
7 0.2
8 0.14
9 0.1
10 0.1
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.05
25 0.05
26 0.04
27 0.04
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.06
34 0.07
35 0.11
36 0.11
37 0.13
38 0.2
39 0.25
40 0.29
41 0.35
42 0.42
43 0.46
44 0.5
45 0.51
46 0.46
47 0.42
48 0.39
49 0.34
50 0.27
51 0.2
52 0.15
53 0.13
54 0.12
55 0.11
56 0.09
57 0.07
58 0.08
59 0.06
60 0.06
61 0.05
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.12
69 0.14
70 0.11
71 0.12
72 0.14
73 0.16
74 0.2
75 0.28
76 0.32
77 0.4
78 0.48
79 0.56
80 0.63
81 0.7
82 0.77
83 0.8
84 0.84
85 0.85
86 0.89
87 0.91
88 0.93
89 0.9
90 0.88
91 0.84
92 0.78
93 0.7
94 0.59
95 0.49
96 0.4
97 0.34
98 0.26
99 0.19
100 0.14
101 0.11
102 0.11
103 0.11
104 0.11