Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N7D4P4

Protein Details
Accession A0A5N7D4P4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRPKKCKHPVASIPRKASSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 8, E.R. 5, cyto_mito 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGKRPKKCKHPVASIPRKASSPHSIIIITPPNVIIVPRLLVLVFLVYNFPFFPFLFLFFLIFNLRFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.83
3 0.74
4 0.65
5 0.57
6 0.52
7 0.47
8 0.39
9 0.32
10 0.28
11 0.26
12 0.25
13 0.27
14 0.25
15 0.19
16 0.16
17 0.15
18 0.13
19 0.13
20 0.13
21 0.09
22 0.06
23 0.06
24 0.06
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.05
33 0.05
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.11
40 0.11
41 0.14
42 0.15
43 0.16
44 0.16
45 0.14
46 0.16
47 0.16