FuNGI

Q750U1

Protein Details

Accession

Q750U1

Localization Confidence

Medium

Confidence Score

12.9

NoLS Segment(s)

Position	Sequence	Protein Nature
1-31	MASVLLLPHQRRKHRQKRARTASYRKPMSQG	Hydrophilic

NLS Segment(s)

Position	Sequence
11-21	RRKHRQKRART
307-309	RRR

Subcellular Location(s)

mito 13, nucl 9, cyto_mito 9

Family & Domain DBs

InterPro	View protein in InterPro IPR018818 Stb3
Gene Ontology	GO:0005737 C:cytoplasm GO:0005634 C:nucleus GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0043565 F:sequence-specific DNA binding GO:0000976 F:transcription cis-regulatory region binding GO:0000432 P:positive regulation of transcription from RNA polymerase II promoter by glucose
KEGG	ago:AGOS_AGL152C -
Pfam	View protein in Pfam PF10330 Stb3

Amino Acid Sequences

MASVLLLPHQRRKHRQKRARTASYRKPMSQGSSPSPAMEVDGPEFPGKTGGQTIAEMGEERSGAGTGNTGTGGQSSVSGAGGKAGALNTAKLVLSHKPISTSSPEAMAAAQQVTPQKLAQLLLAKGPLAIRFITQALTEEIPSFKDLSASKQRRLIMGALEAGDQENSVVFAKIGWGQWSARHVKPHLFIKERELTNVANSKVKDAGVHEARRSSSNAKKGGKSGSFLNELKRPMLAAPTASIYIDENALASDDDEEDDEEDEHDMLNYENLKRRQPSVVAVEPPELSDQQEVLFRARLRAPNGGSRRRSTSKVRSVSVSKPGAHRAPPAAGDAVEGPLRRLSPSQADRKSTIDIATPEEPPHDELLSANSVAKTRRAAARRDSWLSRSKESSIRSTLLSHSNYNIVSPPSHAQPPADHHPLGREADHSDTDEEDWASIGAPALRNNSMPSNLSSSSSHHGNSASASNAHSEQGSPHARPLNYAIPNSIPPRQHSPPDAEDAAFLLMSLKS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.82
2	0.88
3	0.91
4	0.94
5	0.95
6	0.95
7	0.94
8	0.94
9	0.93
10	0.94
11	0.9
12	0.81
13	0.75
14	0.7
15	0.65
16	0.63
17	0.59
18	0.54
19	0.54
20	0.51
21	0.46
22	0.42
23	0.35
24	0.3
25	0.25
26	0.21
27	0.16
28	0.17
29	0.18
30	0.18
31	0.19
32	0.16
33	0.17
34	0.15
35	0.14
36	0.16
37	0.16
38	0.16
39	0.16
40	0.17
41	0.15
42	0.15
43	0.14
44	0.12
45	0.11
46	0.09
47	0.09
48	0.09
49	0.08
50	0.08
51	0.07
52	0.08
53	0.07
54	0.08
55	0.08
56	0.08
57	0.08
58	0.08
59	0.08
60	0.07
61	0.07
62	0.07
63	0.07
64	0.08
65	0.08
66	0.07
67	0.08
68	0.08
69	0.07
70	0.08
71	0.07
72	0.09
73	0.1
74	0.1
75	0.09
76	0.11
77	0.11
78	0.1
79	0.13
80	0.14
81	0.19
82	0.23
83	0.23
84	0.24
85	0.25
86	0.28
87	0.31
88	0.31
89	0.26
90	0.24
91	0.24
92	0.21
93	0.21
94	0.18
95	0.14
96	0.11
97	0.1
98	0.11
99	0.13
100	0.14
101	0.15
102	0.14
103	0.14
104	0.15
105	0.15
106	0.16
107	0.18
108	0.18
109	0.18
110	0.19
111	0.18
112	0.17
113	0.17
114	0.15
115	0.11
116	0.11
117	0.1
118	0.11
119	0.11
120	0.11
121	0.1
122	0.11
123	0.12
124	0.12
125	0.12
126	0.12
127	0.12
128	0.12
129	0.13
130	0.12
131	0.1
132	0.13
133	0.13
134	0.2
135	0.3
136	0.34
137	0.37
138	0.42
139	0.43
140	0.4
141	0.42
142	0.37
143	0.27
144	0.24
145	0.22
146	0.17
147	0.16
148	0.14
149	0.12
150	0.1
151	0.08
152	0.06
153	0.04
154	0.05
155	0.05
156	0.05
157	0.05
158	0.05
159	0.06
160	0.09
161	0.09
162	0.1
163	0.11
164	0.11
165	0.14
166	0.19
167	0.23
168	0.24
169	0.28
170	0.28
171	0.31
172	0.36
173	0.42
174	0.44
175	0.43
176	0.42
177	0.44
178	0.5
179	0.46
180	0.42
181	0.37
182	0.29
183	0.29
184	0.33
185	0.27
186	0.23
187	0.23
188	0.23
189	0.22
190	0.21
191	0.18
192	0.15
193	0.22
194	0.24
195	0.27
196	0.26
197	0.27
198	0.28
199	0.29
200	0.3
201	0.28
202	0.28
203	0.32
204	0.39
205	0.41
206	0.41
207	0.43
208	0.46
209	0.41
210	0.37
211	0.33
212	0.29
213	0.31
214	0.3
215	0.3
216	0.28
217	0.27
218	0.26
219	0.23
220	0.19
221	0.14
222	0.15
223	0.12
224	0.08
225	0.08
226	0.09
227	0.09
228	0.08
229	0.08
230	0.07
231	0.07
232	0.06
233	0.06
234	0.05
235	0.04
236	0.05
237	0.04
238	0.04
239	0.04
240	0.04
241	0.04
242	0.04
243	0.04
244	0.04
245	0.05
246	0.05
247	0.05
248	0.05
249	0.05
250	0.05
251	0.04
252	0.04
253	0.04
254	0.05
255	0.07
256	0.08
257	0.15
258	0.17
259	0.21
260	0.22
261	0.24
262	0.25
263	0.25
264	0.28
265	0.28
266	0.29
267	0.28
268	0.27
269	0.27
270	0.24
271	0.23
272	0.2
273	0.14
274	0.11
275	0.09
276	0.08
277	0.08
278	0.1
279	0.1
280	0.1
281	0.13
282	0.13
283	0.15
284	0.18
285	0.21
286	0.22
287	0.26
288	0.27
289	0.33
290	0.4
291	0.46
292	0.46
293	0.45
294	0.49
295	0.48
296	0.51
297	0.51
298	0.53
299	0.55
300	0.57
301	0.55
302	0.53
303	0.53
304	0.53
305	0.52
306	0.46
307	0.39
308	0.36
309	0.4
310	0.38
311	0.36
312	0.34
313	0.28
314	0.25
315	0.24
316	0.23
317	0.19
318	0.15
319	0.14
320	0.12
321	0.11
322	0.11
323	0.1
324	0.09
325	0.1
326	0.1
327	0.11
328	0.11
329	0.13
330	0.2
331	0.27
332	0.36
333	0.4
334	0.43
335	0.44
336	0.46
337	0.46
338	0.38
339	0.32
340	0.26
341	0.22
342	0.23
343	0.23
344	0.22
345	0.2
346	0.2
347	0.2
348	0.18
349	0.18
350	0.13
351	0.11
352	0.11
353	0.13
354	0.14
355	0.13
356	0.12
357	0.12
358	0.13
359	0.14
360	0.16
361	0.15
362	0.18
363	0.25
364	0.28
365	0.32
366	0.38
367	0.46
368	0.51
369	0.55
370	0.54
371	0.52
372	0.56
373	0.55
374	0.52
375	0.47
376	0.44
377	0.44
378	0.44
379	0.45
380	0.41
381	0.38
382	0.35
383	0.34
384	0.33
385	0.35
386	0.34
387	0.29
388	0.26
389	0.28
390	0.26
391	0.25
392	0.24
393	0.18
394	0.16
395	0.18
396	0.19
397	0.2
398	0.23
399	0.23
400	0.22
401	0.24
402	0.31
403	0.35
404	0.38
405	0.35
406	0.32
407	0.35
408	0.38
409	0.36
410	0.3
411	0.24
412	0.21
413	0.24
414	0.25
415	0.24
416	0.2
417	0.19
418	0.19
419	0.19
420	0.17
421	0.13
422	0.12
423	0.1
424	0.09
425	0.08
426	0.08
427	0.09
428	0.1
429	0.12
430	0.16
431	0.17
432	0.18
433	0.2
434	0.22
435	0.23
436	0.23
437	0.24
438	0.26
439	0.26
440	0.28
441	0.26
442	0.27
443	0.29
444	0.3
445	0.28
446	0.24
447	0.24
448	0.22
449	0.23
450	0.21
451	0.19
452	0.17
453	0.18
454	0.19
455	0.19
456	0.19
457	0.17
458	0.15
459	0.14
460	0.21
461	0.26
462	0.24
463	0.29
464	0.35
465	0.35
466	0.37
467	0.41
468	0.42
469	0.41
470	0.41
471	0.38
472	0.34
473	0.4
474	0.42
475	0.43
476	0.37
477	0.38
478	0.45
479	0.48
480	0.52
481	0.51
482	0.54
483	0.52
484	0.55
485	0.53
486	0.44
487	0.39
488	0.33
489	0.29
490	0.21
491	0.17

Q750U1

3D AlphaFold-predicted Structure Viewer