Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N7CW63

Protein Details
Accession A0A5N7CW63   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
77-97QLDNRPMKKRMRLREQHSCGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.5, cysk 6, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004672  F:protein kinase activity  
GO:0006468  P:protein phosphorylation  
PROSITE View protein in PROSITE  
PS50011  PROTEIN_KINASE_DOM  
Amino Acid Sequences MIYFLHAAGQIRHMLLMGWGGEPIHKLEDVEAIRHEDSRSQKKIRSLGVLHQDLRSDNMLWNAELERVLIIDFHRSQLDNRPMKKRMRLREQHSCGAGVHGRKRLRIGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.09
5 0.07
6 0.07
7 0.07
8 0.08
9 0.09
10 0.1
11 0.09
12 0.09
13 0.09
14 0.09
15 0.15
16 0.15
17 0.16
18 0.16
19 0.18
20 0.18
21 0.19
22 0.19
23 0.18
24 0.25
25 0.32
26 0.37
27 0.38
28 0.41
29 0.45
30 0.5
31 0.47
32 0.46
33 0.39
34 0.38
35 0.43
36 0.42
37 0.38
38 0.33
39 0.31
40 0.25
41 0.25
42 0.2
43 0.13
44 0.1
45 0.12
46 0.12
47 0.11
48 0.12
49 0.11
50 0.1
51 0.09
52 0.08
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.1
59 0.1
60 0.11
61 0.12
62 0.13
63 0.15
64 0.24
65 0.33
66 0.36
67 0.42
68 0.49
69 0.54
70 0.6
71 0.68
72 0.68
73 0.68
74 0.72
75 0.76
76 0.76
77 0.81
78 0.82
79 0.79
80 0.71
81 0.62
82 0.51
83 0.47
84 0.43
85 0.39
86 0.38
87 0.39
88 0.41
89 0.42