Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N6ICB5

Protein Details
Accession A0A5N6ICB5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-71GYCGRRRRGTTRTTRTRRSRIBasic
NLS Segment(s)
Subcellular Location(s) plas 15, vacu 5, mito 2, pero 2, extr 1, E.R. 1, golg 1, cyto_mito 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVVSCIQSVFHAIGACLMGIVNTIGSVCKAIIDGIVTLFDVIISCLTCGYCGRRRRGTTRTTRTRRSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.09
5 0.07
6 0.06
7 0.04
8 0.04
9 0.04
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.07
38 0.13
39 0.21
40 0.28
41 0.36
42 0.44
43 0.51
44 0.58
45 0.64
46 0.68
47 0.72
48 0.76
49 0.8
50 0.8
51 0.84