Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5NW19

Protein Details
Accession A0A5N5NW19    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
68-93DDDHARQRPPPRRAHHRLRRTRTTGPBasic
162-181APPRKPDKPSLPPRPRVPTRBasic
NLS Segment(s)
PositionSequence
73-104RQRPPPRRAHHRLRRTRTTGPASPTRPAEKKR
130-183PPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLP
Subcellular Location(s) nucl 13, cyto_nucl 12.5, cyto 10, mito 3
Family & Domain DBs
Amino Acid Sequences MPHQLPGAGPFTTYRDAEDDSALIYFCEPEITTTSDFGRKERSPTLARIYRFFINFCDFEGFSTTITDDDHARQRPPPRRAHHRLRRTRTTGPASPTRPAEKKRLPEDELLHGTAPRGNVTPIGEEGAPPPASRPRRERAAYGAAHQRRRTTPPREPPRTGAPPRKPDKPSLPPRPRVPTRLPHTHYKGKPTTPSSGRTFTRQETEVRRRDGRGGFASAATRSAPRRRPSLLDGVAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.23
4 0.24
5 0.23
6 0.19
7 0.16
8 0.16
9 0.14
10 0.11
11 0.09
12 0.08
13 0.06
14 0.08
15 0.07
16 0.08
17 0.11
18 0.15
19 0.16
20 0.17
21 0.2
22 0.23
23 0.24
24 0.24
25 0.29
26 0.27
27 0.32
28 0.34
29 0.39
30 0.38
31 0.42
32 0.5
33 0.48
34 0.48
35 0.45
36 0.45
37 0.43
38 0.4
39 0.36
40 0.3
41 0.28
42 0.27
43 0.26
44 0.25
45 0.21
46 0.2
47 0.23
48 0.2
49 0.16
50 0.16
51 0.15
52 0.11
53 0.11
54 0.11
55 0.09
56 0.12
57 0.18
58 0.2
59 0.21
60 0.26
61 0.35
62 0.44
63 0.5
64 0.56
65 0.58
66 0.66
67 0.74
68 0.8
69 0.82
70 0.83
71 0.86
72 0.85
73 0.86
74 0.82
75 0.79
76 0.76
77 0.72
78 0.66
79 0.6
80 0.59
81 0.52
82 0.49
83 0.46
84 0.44
85 0.42
86 0.41
87 0.45
88 0.43
89 0.48
90 0.52
91 0.55
92 0.52
93 0.51
94 0.5
95 0.46
96 0.42
97 0.36
98 0.29
99 0.23
100 0.2
101 0.17
102 0.14
103 0.1
104 0.08
105 0.07
106 0.08
107 0.09
108 0.09
109 0.08
110 0.09
111 0.08
112 0.08
113 0.08
114 0.1
115 0.1
116 0.09
117 0.1
118 0.16
119 0.2
120 0.25
121 0.3
122 0.32
123 0.4
124 0.42
125 0.42
126 0.41
127 0.45
128 0.41
129 0.39
130 0.44
131 0.41
132 0.45
133 0.45
134 0.43
135 0.38
136 0.45
137 0.49
138 0.48
139 0.52
140 0.58
141 0.68
142 0.71
143 0.72
144 0.69
145 0.69
146 0.7
147 0.69
148 0.69
149 0.67
150 0.69
151 0.7
152 0.74
153 0.68
154 0.66
155 0.68
156 0.68
157 0.7
158 0.71
159 0.76
160 0.75
161 0.79
162 0.81
163 0.77
164 0.73
165 0.7
166 0.68
167 0.67
168 0.7
169 0.67
170 0.66
171 0.69
172 0.72
173 0.68
174 0.68
175 0.66
176 0.61
177 0.65
178 0.59
179 0.61
180 0.55
181 0.58
182 0.54
183 0.55
184 0.52
185 0.5
186 0.5
187 0.45
188 0.46
189 0.42
190 0.43
191 0.46
192 0.54
193 0.56
194 0.58
195 0.58
196 0.55
197 0.61
198 0.58
199 0.54
200 0.49
201 0.45
202 0.39
203 0.37
204 0.37
205 0.3
206 0.27
207 0.22
208 0.21
209 0.24
210 0.32
211 0.38
212 0.41
213 0.47
214 0.51
215 0.56
216 0.58
217 0.62
218 0.56